KEGG   Frankia casuarinae: Francci3_4428Help
Entry
Francci3_4428     CDS       T00320                                 

Definition
(GenBank) Haloacid dehalogenase-like hydrolase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
fra  Frankia casuarinae
Pathway
fra00630  Glyoxylate and dicarboxylate metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Francci3_4428
Enzymes [BR:fra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     Francci3_4428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD HAD_2 Hydrolase_like SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ABD13774
RhizoBase: Francci3_4428
UniProt: Q2J4L8
LinkDB All DBs
Position
complement(5293851..5294492)
Genome map
AA seq 213 aa AA seqDB search
MSFWRASVPVVGFDLDLTLLDARHGIRATFAVLSAETGVAVDAETVVARLGPPLETELAH
WFPLAEVAAVAARYRELYAVHALPASLPMPAAVAAVAAVRRLAGRVVVVTAKSTALARAS
LDRIGITADVVEGARFAQTKGEALRAHRVDVFVGDHVGDMVGARDGGALAVGVATGPCSA
ADLLSAGADVVLPRLADFPPWLVDEARRRRQPG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgttctggcgggcatccgtcccggtcgtcgggttcgatctcgatctgaccctgttg
gatgcccggcacggcatccgggcgaccttcgccgtcctgtccgccgagaccggggtggcg
gtggacgccgagacggtcgtcgcccggctcggcccgccgctggagacggagctcgcccac
tggttcccgctggccgaggtcgcggccgtggcggcccgctaccgcgagctctacgcggtc
cacgcgctgccggcgtcgctgccgatgccggccgcggtggccgcggtggccgcggtgcgg
cggctagccggccgggtagtggtcgtcaccgcgaagagcacggcgctggcccgcgcgagt
ctggaccggatcggcatcaccgccgacgtggtggagggagcccggttcgcgcagacgaag
ggcgaggccctgcgcgcccaccgcgtggacgtcttcgtcggtgaccacgtcggcgacatg
gtcggcgcccgcgacggcggtgctctcgccgtcggggtcgccaccgggccctgctcggcc
gccgatctgctctccgccggcgccgacgtcgtcctcccccggctggccgacttcccgccc
tggctggtcgacgaggcccggcgccgacgacagccgggctga

DBGET integrated database retrieval system