KEGG   Francisella sp. CA97-1460: KX01_365Help
Entry
KX01_365          CDS       T05636                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
frc  Francisella sp. CA97-1460
Pathway
frc00020  Citrate cycle (TCA cycle)
frc00190  Oxidative phosphorylation
frc00650  Butanoate metabolism
frc01100  Metabolic pathways
frc01110  Biosynthesis of secondary metabolites
frc01120  Microbial metabolism in diverse environments
frc01130  Biosynthesis of antibiotics
frc01200  Carbon metabolism
Module
frc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
frc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
frc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:frc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KX01_365
   00650 Butanoate metabolism
    KX01_365
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KX01_365
Enzymes [BR:frc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KX01_365
    1.3.5.4  fumarate reductase (quinol)
     KX01_365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_7 Fer4_4 Fer4_9
Motif
Other DBs
NCBI-ProteinID: APC97152
UniProt: A0A1J0KTP4
LinkDB All DBs
Position
complement(349013..349714)
Genome map
AA seq 233 aa AA seqDB search
MEVKFKIYRYNPEVDTKPYYDDYTVKVENEGVKVLTALELIKEQDPTLAMRRSCREGVCG
SDGMNINGKNRLACVTSIGELRQPIKVNPLPGLPVVRDLIVDMKQFYKNYEKVKPYLINN
DEAPIKERLQSPEERAKLDGLYECILCACCTTSCPSFWWNPDKFIGPSGLLQAYRFIADS
RDTATDERLEALKDPFSLFRCRTIMNCVTVCPKGLNPTEAIGKIRSAMLKKSV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaatttaaaatttatagatacaatccagaagtagatacaaagccatattac
gatgactatacagttaaagtagaaaatgaaggggtaaaagtattaactgctttggaatta
attaaagagcaagatcctactttagcgatgagaaggtcttgtcgtgagggtgtttgcggt
tctgatggaatgaatataaatggtaaaaaccgtttggcttgtgttacatctataggagag
cttagacagcctattaaagtaaatcctttaccaggtcttcctgttgttagagatttgatt
gtagatatgaaacagttctacaaaaactatgaaaaagttaagccgtatttaattaataat
gatgaagctcctataaaagagagattacaatctccagaagagagagctaaattagatggt
ttatatgagtgtattctttgtgcgtgttgtactacctcttgcccatctttctggtggaat
cctgataaatttattggaccatcaggattgttgcaagcatataggtttatagcagattca
agagacactgcgactgatgagagactagaagctcttaaagatccatttagcttgtttaga
tgtagaactatcatgaactgtgttactgtttgccctaaaggcttaaatcctactgaagct
attggtaagatcagatcagctatgcttaagaagagtgtgtaa

DBGET integrated database retrieval system