KEGG   Francisella sp. CA97-1460: KX01_366Help
Entry
KX01_366          CDS       T05636                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
frc  Francisella sp. CA97-1460
Pathway
frc00020  Citrate cycle (TCA cycle)
frc00190  Oxidative phosphorylation
frc00650  Butanoate metabolism
frc01100  Metabolic pathways
frc01110  Biosynthesis of secondary metabolites
frc01120  Microbial metabolism in diverse environments
frc01130  Biosynthesis of antibiotics
frc01200  Carbon metabolism
Module
frc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
frc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
frc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:frc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KX01_366 (sdhA)
   00650 Butanoate metabolism
    KX01_366 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KX01_366 (sdhA)
Enzymes [BR:frc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KX01_366 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     KX01_366 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 GIDA FAD_binding_3 HI0933_like RICH NAD_binding_8 OPA3 Halogen_Hydrol Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: APC97092
UniProt: A0A1J0KTY2
LinkDB All DBs
Position
complement(349730..351523)
Genome map
AA seq 597 aa AA seqDB search
MSIAKQEFDAIVVGAGGAGLRAAFQLSQSGFKTAVVSKVFPTRSHTVAAQGGIAAALGNI
KFDDDLPSDDWKWHMYDTVKGSDYLGDQDAIEYMCEHAPQSIIELEHMGMPFSRLEDGKI
YQRAFGGMSRNYDPANQAKRTCAASDRTGHALLHTLYQGNLAHDTNFYTEWYAVDLVKAD
DGSIAGVIALCIETGETVFLQAKITILATGGAGRIYESSTNAYINTGDGLGLALRADIPL
QDMEFWQFHPTGIAGAGVLVTEGCRGEGGILRNKDGERFMERYAPMAKDLACRDVVSRAS
QQEIMEGRGDTFSGSSCVWLDLTHLGEDVIDERLPTVRELAKTFAGVDPVEKPIPVVPTC
HYQMGGVPTNKYGQVITQINGEDKIIGGLYAVGECASVSVHGANRLGSNSLLDLVVFGRA
AGMHAEESLKHGMKRKDASEENVQKALERLNRWDSSEQRGCKEKIVDLRKELQQIMQKYF
SVFRQESTMKEGLEELLKLRERLENAVLEDNSRIFNMTRIEALELDNLMLTAVATAKLAL
ERKESRGAHSRVDYPNRDDENWMKHTLYFLDGDKTSSRSVNMSPTKVKAFQPAERKY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagctaaacaagagtttgatgctattgtagtcggagctggaggggctggtctt
agagcagcatttcaattatctcaatctggattcaaaacagctgttgtatcaaaggttttt
cctacaagatctcatactgttgcagcacaaggcggtattgcagcggctttaggtaatatt
aagtttgatgatgatttaccttcagatgattggaaatggcatatgtatgataccgtgaag
ggttctgattatcttggagatcaggatgctattgagtatatgtgtgaacatgcgccacag
tctattattgaattagagcatatgggtatgcctttttctcgtttggaagatggtaaaatt
tatcaaagagcttttggtggaatgtctagaaattatgatccagcaaatcaagctaaaaga
acttgtgcagcatcagatagaacgggacatgctcttttgcatacgctttatcaaggtaat
ttagctcatgatacaaacttctatactgaatggtatgcggttgatttagtaaaggctgat
gatggtagcatcgctggtgttatagctctttgcatagagactggagaaacagtttttctg
caagcaaaaattacaattttagcaactggtggagctggacgtatttatgagtctagtaca
aatgcttatatcaatacgggtgatggtttaggtcttgccttaagagcagatatacctctt
caagatatggagttttggcaatttcacccaacgggtattgctggagctggtgtgcttgtt
actgaaggatgtcgtggagaaggtgggatccttagaaataaagatggtgagagatttatg
gagagatatgctccaatggctaaagatcttgcttgtcgtgatgtggtttctcgtgcttct
caacaagaaattatggaaggaagaggagatacttttagtggttctagctgtgtatggtta
gatcttactcacttaggtgaagatgttattgatgaaagattgccaacagttagagagtta
gctaaaacattcgctggcgttgatcctgttgagaagcctattccagttgtaccaacatgt
cattatcagatgggcggtgtaccaactaataagtatggtcaagttataactcaaataaat
ggcgaagataaaattattggtggattatatgctgttggcgagtgtgcgtctgtatctgtt
catggtgcaaataggctaggaagtaactcgttacttgatcttgttgtgtttggtagagct
gcgggaatgcatgcggaagaaagcttgaagcatggtatgaagcgaaaggatgcttcagaa
gagaatgtgcagaaagctttagaaagattaaatagatgggactcttctgaacagagaggt
tgtaaagaaaaaatagttgatcttagaaaagaattgcaacaaataatgcaaaaatatttt
tctgtatttagacaagaaagtactatgaaagaaggtttagaagagcttcttaagttaaga
gaaagattagaaaatgctgtattagaagataatagtagaatcttcaatatgacaagaatt
gaagctttagagcttgataatctaatgttaacagcagttgcaacagctaaattagcttta
gaaagaaaagagtctcgtggagctcactcaagagtggattatccaaatagagatgatgaa
aattggatgaaacatactttatacttcctagatggagataaaacttcttcaagaagtgtt
aatatgtcgcctacaaaagttaaagcattccaaccagctgaacgtaaatactaa

DBGET integrated database retrieval system