KEGG   Frankia sp. EAN1pec: Franean1_0977Help
Entry
Franean1_0977     CDS       T00608                                 

Definition
(GenBank) Superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
fre  Frankia sp. EAN1pec
Brite
KEGG Orthology (KO) [BR:fre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Franean1_0977
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Franean1_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: ABW10433
RhizoBase: Franean1_0977
UniProt: A8L2P0
LinkDB All DBs
Position
complement(1141645..1142043)
Genome map
AA seq 132 aa AA seqDB search
MSLLHPAISVSAHCDLPCGVYDPAQAKVEAQSVKAIQEKYQANTDPEFRARALVIKEERA
ELVKHHLWVLWTDYFKPNHLEKYPQLHDLFWQATKAAGAAGAKGSVDPTQGQKLLDLIDE
ISTIFWETKAAA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctgcatcccgcgatcagcgtcagtgcccactgtgacctgccctgcggcgtc
tacgacccggcccaggcgaaggtcgaggcccagtcggtcaaggccatccaggagaagtac
caggccaacacggacccggagttccgggcccgggcgctcgtcatcaaggaggagcgcgcc
gagctggtcaagcaccacctctgggtgctctggaccgactacttcaagccgaaccacctc
gagaagtacccccagctgcatgacctgttctggcaggccaccaaggcagccggcgcggcc
ggcgccaagggctcggtcgacccgacgcagggccagaagctcctggacctgatcgacgag
atctccacgatcttctgggagacgaaggccgccgcctga

DBGET integrated database retrieval system