KEGG   Frankia sp. EAN1pec: Franean1_3269Help
Entry
Franean1_3269     CDS       T00608                                 

Definition
(GenBank) MMPL domain protein
  KO
K06994  putative drug exporter of the RND superfamily
Organism
fre  Frankia sp. EAN1pec
Brite
KEGG Orthology (KO) [BR:fre00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Franean1_3269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL
Motif
Other DBs
NCBI-ProteinID: ABW12675
RhizoBase: Franean1_3269
UniProt: A8LFN8
LinkDB All DBs
Position
complement(3869841..3872339)
Genome map
AA seq 832 aa AA seqDB search
MIGYGVERRVAERLGTVDGGPAPGQQFFGIGPSPPGEATSITLTGRQVANRPFSWYSWGC
PAKTAGDDHLPIGKHQPAGALPSRPGTLPEETSEVATYLYRLGRLAYRRRRLTTALWLAA
LALVGVGAAALSGPTSDAFSIPGSESQQAFDLLAERMPGGGADNASARVVFTAPENGTLS
TGPGRAGVEQTVAALGQAPQVASVTDPFTADGVAEDGQTAYAQVTYSVQSVDVTEEAREG
LFHAAAPAEAAGLAVEYGGTAMEEVPEQSATEIIGLLVAAVVLLITFGSLVAAGLPLLTA
ALGVIFGMAGIQIATGFFDLGSSTSTLALMLGLAVGIDYALFVTSRYRHEISLGLEGEEA
AGRAVGTAGSAVVFAGLTVVIALAALAVVGIPFLTSMGLAAAGTVAIAVVIALTMLPAMF
GFAGGRIAGGRVAGLRGRDPEDSGPRVAMGERWARLVVRRRVPALLLGVLVLGLVALPAT
DLRLGMPDDSTAAEDTTQRKAYDQLAEGFGPGFNGPLLLVVDVAGNPAPQGVVERVRQAA
AALPGVVTVTAPVFNQAGDTATLSVVPATGPSDKATEDLVHALRDSASAATAVGGAASYV
TSSTAMNIDVSETLSDALLPYLAVVVGLAFVLLALVFRSILVPLKATVGFLLSVVATFGA
VVAVFQWGWMMDLLGVDSTGPIVSFLPIFLIGVLFGLAMDYEVFLVTRMREEYVHGQAPD
DAVVLGFRHGARVVTAAAIIMISVFAGFILAPEPIIQSLGFALAFGVLVDAFVIRMTLVP
AVMSLLGRHAWWLPRWLDRALPDIDVEGSRLEQAVATQGQPREPRESELVRG
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgggtacggggtggagcgtcgcgtcgccgaaagactcggcacggtcgatggcggt
cccgcgcctggccagcagttcttcggtatcggcccgtcccctcctggcgaggcaacaagc
atcacacttaccggacggcaggttgctaaccggccgttcagttggtactcctgggggtgt
ccagcgaaaacagccggagacgaccacctgccgatcggcaagcaccagccggccggggca
ctcccctcccgcccgggaaccctccccgaggagacatctgaagtggccacctacctgtac
cggcttggacggctggcgtaccggcgccgccgccttaccacagccctgtggctggcggcg
ctggcgcttgtcggcgtcggcgcggcggccctgtccggcccgacatcggacgcgttctcg
attccgggcagcgaatcccagcaggccttcgacctgctggccgagcggatgcccgggggc
ggtgcggacaacgcctcggcccgcgtcgtcttcaccgctcccgagaacggcacgctgagc
accgggccgggccgggccggggtcgaacagaccgtcgccgcgctcgggcaggccccccag
gtcgccagcgtgaccgacccgttcacggcggatggcgtcgccgaggacggccagaccgcc
tacgcccaggtcacctactcagtgcagagcgtcgacgtcaccgaggaggcgcgcgagggc
ctgttccacgccgccgccccggccgaggccgccggtctcgccgtcgagtacggcgggacg
gcgatggaggaggtgcccgagcagagcgccactgagatcatcgggctgctcgtcgcggcg
gtggtgctgctcatcaccttcggttcgctggtcgcggccgggctcccgctcctcaccgcc
gcgctcggcgtcatcttcgggatggccgggatccagatcgcgaccggtttcttcgatctc
ggttccagcacctcgacgctcgccctgatgctcgggctcgcagtcggcatcgactacgca
ctgttcgtcacctcccggtaccggcacgagatcagccttggtctcgagggcgaggaggcc
gccgggcgcgcggtcggcaccgccggctccgcggtcgtgttcgccgggctgaccgtcgtc
atcgcgctggccgcgctggccgtcgtgggcatcccgttcctgacctcgatggggctggcc
gcggcggggacggtggcgatcgccgtcgtgatcgcgttgaccatgctgcccgccatgttc
ggtttcgccggcggacggatcgccggcggccgggtagcgggactgcgcggccgcgacccg
gaggacagcggcccccgggtggccatgggggagcggtgggcgcggctggtcgtccgccgc
cgggtccccgccctgcttctgggcgtgctggtgctcggcctggttgccctgcccgccacc
gacctgcggctcgggatgcccgacgacagcacggcagccgaggacaccactcagcgcaag
gcctacgaccagctggccgagggattcggtcccggcttcaacggcccgctgctgctggtc
gtcgacgtcgccggaaaccctgccccgcagggagtggtcgagcgtgtgcggcaggctgcg
gccgcgctgccgggcgtcgtcaccgtgacggcgccggtcttcaaccaggccggggacacc
gccactctcagcgtggtgccggccacggggcccagtgacaaggcgaccgaggacctcgtc
cacgcactccgcgactccgccagcgccgccaccgcggtcggtggtgccgccagctacgtc
accagctccaccgcgatgaacatcgacgtctcggagacactgtccgacgcgctcctgccc
tacctggccgtcgtcgtcgggctggccttcgtgctgctggccctggtgttccgcagcatc
ctggtgccgttgaaggccactgtcggcttcctgctcagcgtggtcgccacgttcggcgcg
gtggtcgcggtgttccagtggggctggatgatggacctgctcggcgtcgactccaccggc
ccgatcgtcagcttcctgccgatcttcctgatcggcgtgctcttcggcctggcgatggac
tacgaggtgttcctggtcaccaggatgcgggaggagtacgtccacggccaggctcccgac
gacgcggtcgtgctcggtttccggcacggagcccgagtggtcactgccgccgcgatcatc
atgatctcggtcttcgccgggttcatcctcgcacccgaaccgatcatccagtcgctgggt
ttcgccctggcgttcggtgtcctcgtggacgcgttcgtcatccggatgactctggtgccc
gcggtgatgtcgctgctcggccggcacgcctggtggctgccgagatggctggaccgtgcc
ctgcccgacatcgacgtcgagggcagccggctggagcaggctgtcgccacgcagggccag
ccccgggaaccccgggaatcggaactcgtccgcggctga

DBGET integrated database retrieval system