KEGG   Frankia sp. EAN1pec: Franean1_3377Help
Entry
Franean1_3377     CDS       T00608                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
fre  Frankia sp. EAN1pec
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABW12779
RhizoBase: Franean1_3377
UniProt: A8LH08
LinkDB All DBs
Position
4001735..4003183
Genome map
AA seq 482 aa AA seqDB search
MLEREQMFVGGAWVAPSTDSRIEVTSPHTEKLIGRVAAASTEDVDRAVAAARRAFDEGPW
PRTDPAERVEVIRRLATLYRGHRDELAELITAELGAPISFARRAQVALPGALMTALADTA
AGYSWQEKRPGTYGQDIILRKEPVGVVAAVVPWNMPQFLTVTKVIPALLAGCTVVLKPAP
ESSLDALFFADLLDQVGLPPGVVNVLPADREVSAYLVAHPGIDKVSFTGSTAAGRQVAAA
CAPNLTKVSLELGGKSAAIALDDADPATVARAVRLSGMGMAGQICNSLTRVLVPTSRVGD
YADALAATLSAIRIGDPADPATEMGPLVARRQQERVRQYIDTGVREGARLVVGGTDLPDG
IDRGWYVRPTVFSDVDNAMTIAREEIFGPVLVVIPYGDEDEAVRIANDSEYGLAGSVFTA
DTGHGLEVAGRVRAGTFGVNQGYSMDPAAPFGGVKASGYGRELGREGLEGYLDVKSISVA
TA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgttggagcgggagcagatgttcgtcggaggcgcgtgggtcgcgccgagcaccgacagc
aggatcgaggtgacctcgccgcacaccgagaagctgatcggtcgcgtcgccgcggcgagc
acggaggacgtcgaccgcgccgtcgccgcagcgcggcgggcctttgacgaggggccgtgg
ccgcggaccgatccggccgagcgggtcgaggtgatccggcggctggccacgctctaccgc
gggcatcgcgatgagctggccgagctcatcaccgccgagctgggcgcgccgatctcgttc
gccaggcgcgcgcaggtcgccctgcccggggcgctgatgaccgcgctggccgacacagcg
gccggctactcctggcaggagaagcggccgggaacctacggccaggacatcatcctgcgc
aaggagcccgtgggcgtcgtcgccgcggtggtcccctggaacatgccgcagttcctgacc
gtcaccaaggtcatcccggcgctgctcgccggctgcaccgtcgtgctcaagccggcgccc
gagtcgtcgctcgacgcgctgttcttcgccgacctgctcgaccaggtcggcctgccgccg
ggcgtcgtcaacgtcctccccgccgaccgtgaggtgagcgcctacctagtcgcccacccc
ggtatcgacaaggtctccttcaccggctcgacggcggccggcaggcaggtggcggcggca
tgcgctcccaacctcaccaaggtcagcctcgagctcgggggaaagtcggcggccatcgct
ttggacgacgccgacccggccaccgtggcgcgcgccgtccgcctctcgggcatgggcatg
gccgggcagatctgcaactccctcacccgggtactcgtgcccacgagccgcgtcggcgac
tatgccgatgcgctcgcggcaaccctgtcggccatcagaatcggcgatccggccgatccc
gcgaccgagatgggcccgctcgtggccaggcgccagcaggaacgggtccgccagtacatc
gacaccggcgtgcgggagggcgcccggctcgtcgtcggtggcaccgatctgcccgacggg
atcgatcgcggttggtacgtgcgaccgaccgtcttcagcgacgtggacaacgcgatgacg
atcgcccgggaggagatcttcggcccggtccttgtcgtcatcccctacggcgacgaggac
gaggccgttcgcatcgccaacgactcggagtacggcctggccggctccgtgttcaccgcg
gacaccgggcacgggctcgaggtggcgggccgggtccgggccgggactttcggcgtgaac
cagggctactccatggatcccgcggcccccttcgggggagtgaaggccagcggctacggc
cgcgagctcggccgtgagggcctcgagggctacctcgacgtcaaatcgatctccgtcgcc
accgcgtag

DBGET integrated database retrieval system