KEGG   Frankia sp. EAN1pec: Franean1_3889Help
Entry
Franean1_3889     CDS       T00608                                 

Definition
(GenBank) Beta-ketoacyl synthase
Organism
fre  Frankia sp. EAN1pec
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C KAsynt_C_assoc PS-DH PP-binding Thiolase_N adh_short Docking ACP_syn_III Epimerase HEAT_2 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ABW13279
RhizoBase: Franean1_3889
UniProt: A8L4B1
LinkDB All DBs
Position
4642187..4652668
Genome map
AA seq 3493 aa AA seqDB search
MSNEDRLRHFLKQATAELRQATQRVRELEEADHEPIAIVGMACRFPGGVSSPEQLWDVVS
GGHDAVSEFPVDRGWDVAGLYDPVPARVGRSYVRSGGFLAGAADFDAGFFGISPREALAM
DPQQRLLLEVSWEALERAGVDPSSLRGSDTGVFTGLIYQGYGGESVTASEGVEGYRISGT
ASSVASGRVAYVLGLEGAAVTVDTACSSSLVALHLAVRALRAGECGMALVGGVTVMSTPV
GFVEFSRQRGLAADGRVKAFAEGADGTGWGEGVGVLVVERLSVARARGHGVLAVVAGSAV
NQDGASNGLTAPSGRAQERVIRAALADAGAAPGDVDVLEAHGTGTALGDPIEAGALLGVF
GPGRPADRPLWLGSVKSNIGHAQAAAGVAGIIKIVEALRHQAVPATLHVDAPTSRVDWAS
GGVRVATEQVAWPPEPGRRRRAGVSSFGMSGTNAHIVIEEAPPAAPESESEPGAVAGPGA
AAGPVGAVPWILSARSEQGLLAQAARLASRLDAEPTPGSPTPRPSSRAADRPSARDVGWS
LARGRAALEHRAVVLGERGAGDAQVGGDRLAGLRALAADEPVETVVRGRVGTSGDRVVWV
FPGQGAQWVGMGAELLDALPVFAGRVAECAAALAPFVDWSLVDVLRGASDAPGAAGIAGV
EGIVGVEGAGLLERVDVLQPVSWAVALGLAAVWESWGVRPDVVVGHSQGEIVAACVAGVL
SVDDGARVVAARSRVIAGELAGCGGMASVALPVGEVEARLRVGAGRVEVAAVNGPSATVV
AGEPAALDDLLSVWEAEGVRVRRLPVDYASHTAQVDRVRDRLTTELAGIAPRAGTAEMWS
TVTGSPVDPGQLDGEYWFRNLRSTVRLHEVADVLVGEGHRVFVEISPHPVLTAAITETAE
AAGVPDAVVVGSLRRGDGGPDRLAAAAAQLWVRGVPVDWAPLVAGGRQVDLPTYPFQHQR
YWLLGDGRPAGGAASGGGAAGGTDLDGLRYRVGWHPLGPEPSRAAPAAATGRWLMVTPFP
AADDVPPLAADAVRALAEDGAEIVSVPVGPAELTREGLAGRLRAVTGAGESDPRGVLSLL
ALTGTAQPDGPPRADGADSADSAVGADGAVGTVGATATLLLVQALGDAGIGAPLWCLTRG
AVSVGGGDPVTDPAQAQTWGLGRVAALEHPSRWGGLVDLPDTLDGSARRRLAAVLRGATD
EDQVAIRAGTVFARRLLRAPLGGTEPARRWRPRGTVLVTSTGPLGPHLAGWLAERGAGHV
VLAGSHRADDPDIAALRHGAFTGDVRLTVATCDLADREALAAVVRGQAADGEGIRAVVHT
AALLGLRPLADTSVTDLAGAIAAKATAADWLDELFPTDDLDAFVLFSSVVGVWGGADHAA
YAAANAHLDALAERRRARGLPATSIAWGLWRPLAESGSAGAGAAAAEDPGVRRQRARGLG
YLEPDRALDALRQVLDHDETHIVVAEIDWTRFIPVFTSAGRRPLFDTLAEDAGAAGEARM
SGVADGAASPAASGTGSPLARRLAALPPAERDRALVETVRTRAAAVLGHSDATAVEAHRA
FRDLGFDSLTSVDLRNGLGAALGLRLPSTLVFDYPTPLTLAEFLRVEITGGDADDAPAAG
VPGAVASRDRSGHGGEHDLLDAEPVAIVAMACRLPGGVDSPEDLWRLLAEGRDAIGEFPA
DRGWDLDALHDPDPERSGTSYVRHGGFLAGVADFDAEFFGINPREALAMDPQQRLLLELS
WEAVERAGIDPSTLRGTPGGVFVGTNVQDYGPRALAAGAETEGYIGIGNAASVMSGRISY
TLGLQGPAVTVDTACSSSLVALHQAVQALRRGECSLALAGGAVVMSSPLMYVEFSRQRAL
SPDGRCRAFGAGGDGTGLSEGVGLLVLERLSDARRAGRPVLAVVEGTAVNSDGASNGLSA
PNGPAQQRVIRQALAVAGLSPSEVDAVEAHGTGTKLGDPIEAQALIAAYGRDRPAGRPLW
LGSLKSNIGHTQAAAGVAGVIKMVLAMRYGVLPRTLHADEPTPQVDWDGAGVRLLTDEVA
WPARPLPDAAPAGRERAGERGPRRAAVSAFGISGTNAHVILREAPATEEPRVGPAPSPAS
SPRPVPLLVSARTTEGLRAQARRLAAHLDDRPGPAAADVALATAATRAAFDHRAVVVGAD
HDELRAGLVELAGDQDPADGTAPVGVRQPRGLVVRGVAVPDPRVVFVFPGQGSQWSGMGR
ELLESCPPFRERMTECAAAFEPYLDWSLLDVIRGAGDTPPLEAIEVIQPALMSMMVSLAA
AWRAYGVTPAAVVGTSQGEVAAAHVAGALSLADAARIIALRSRLLATRLLGRGALASVGL
PPADVAARLDRFGGRLAVGGINGPRQVTVAGETGALDDLVAELTAEGVRARLVAASVATH
CAQVDGIRPELMEILRPLAPTPARIPVYSTVTGGPLDAAALDAEYWYSNTREPVLLDGAA
RALLAAGFDTFVEVSPHPVVGFGLAETAHDAGRDAVVVSTLQRGRGGADRLLAALAEVHV
HGVGVDWREAFAGTGAHPADLPTYAFQRRRFWPRPAPARPADAAAAPGRDGPAHPLVTAA
VPMADGSLLLTARISPAAQPWLAGRTVAGVPVVPDGVLLELAIQAGDEVGCPEVTDLALT
GPLVLPESGALRLQLHAGAPDGTGNRALTVHARTDGAPADAPWTAHATATLAGTADPAAS
VPDPRAWPPPGAVPVDVDRLYGELLAAGHGHGPDGPRLTRAWQAGTDLFAEAVLDGEHEV
AGFGLHPVLLEVAGHLALWGRLPAAGAEPPAEPPAVLGVEPPAVSEPVVAVDGGYRGVRL
YATGARAVRVRVGPAGAGAVSVELADHTGAAVAAYGSTGLRPLAAARLRALRTSAADSMF
ALDWVPVAPARASGAGAPGWAVLGPDPLGLRTALALAGVHAPACLDLAAAAALPAIPDVV
LVTSDSAAAGPDLAAAARTALRSVLALAQEWLRDDRFAAARLVVVTRGAVAVGAHDDVTS
LADAAVWGLLGSAAAENPDRFLLVDVDGTPASERALPAAVACGEPRVALREGAVLGQRLV
RAPVAGAGVDAGRARWRPDGTVLITGGTGTLGGLVARHLVTGYGIGNLLLVSRGGAGSPG
VAELTDDLTALGARVTVAACDVADRAALAGVLAAIPAAHPLTAVVHAAGTLDDGVFSAMT
PERLDTVLRPKMDAALHLHELTRGDDLAAFVLFSSSAAAFGSAGQANYAAANTFLDALAH
HRRAAGLPALALGWGYWAPRSALAGHLDAAALDQRMAANGLRPISAAAGMALFDAALTAD
RPVLLPMRLDPRAPRAGAVPALLRGLVRHPARRSVDGAADDPVETLARRLAGAGGPERDR
ALLDVVCATAAAALGHTSAAEVAPDRPFRELGFDSLASVQFRNRLTAATGLRLRPMLVFD
FPTPEAIAGHLRDQLFPEVAPAAAGPPTAAPAPAPAGPSDPEPPAAPGGGEPASAFDEMD
AETLVRLALGEGT
NT seq 10482 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaggaccggctgcgccattttctgaagcaggcgacagccgagcttcgtcag
gccacccagcgggtgcgcgagctggaggaggccgaccacgagccgatcgcgatcgtggga
atggcctgccgtttcccgggcggggtgtcgtccccggagcagctgtgggatgtcgtctcc
ggcgggcacgacgcggtgtcggagtttccggtggatcggggttgggatgtggcgggtctt
tatgatccggttcctgctcgggtgggtcggagttatgtgcggtcgggtggttttctggct
ggtgcggctgattttgatgcgggtttttttgggatttcgccgcgtgaggcgttggcgatg
gatccgcagcagcggttgttgttggaggtgtcgtgggaggcgttggagcgggcgggggtg
gatccgtcgtcgctgcgtggcagcgacaccggcgtcttcaccggcctgatctaccaggga
tacggcggcgagtcggtgacggcgtccgagggtgtggagggctatcggataagtgggacc
gcctcgagcgtggcctccggtcgggtggcgtatgtgttggggttggagggggcggcggtg
acggtggatacggcgtgttcgtcgtcgttggtggcgttgcatctggcggtgcgggcgttg
cgtgcgggtgagtgtgggatggcgttggtgggtggggtgacggtgatgtcgacgccggtg
ggttttgtggagttttcgcggcagcgggggttggctgctgatgggcgggtgaaggcgttt
gcggagggtgcggatgggacggggtggggtgagggggtgggtgtgttggtggtggagcgg
ttgtcggtggcgcgggctcgggggcatggggtgttggcggtggtggcgggttcggcggtg
aatcaggatggtgcgtcgaatggtttgacggcgccgagtggtcgggcgcaggagcgggtg
atccgggccgcgctcgcggacgcgggagcggcgccgggcgacgtggacgtgctggaggcg
cacgggaccgggacggcgttgggcgacccgatcgaggcgggggcgctgttgggggtgttc
ggcccgggccgcccggccgaccggccgctgtggctggggtcggtgaagtcgaacatcggg
cacgcgcaggcggccgccggggtggccgggatcatcaagatcgtggaggcgctgcgccat
caggcggtgccggcgaccctgcacgtggacgcgccgaccagccgggtggactgggcctcg
ggcggggtccgggtggcgaccgagcaggtcgcgtggccgccggagccgggccgccgccgg
cgcgcgggggtctcctcgttcgggatgtcgggcacgaacgcgcacatcgtcatcgaggag
gccccgccagccgcccccgagtccgaatcggagcccggggctgtggccgggcccggggcc
gcggccgggccggtcggtgcggtgccgtggatcctctcggcacggtcggagcagggcctg
ctggcgcaggccgcccggctggcgtcgcgcctggacgccgagccgacgcccggttcgccc
acgccacgaccgtcttcccgtgccgcggaccggccgtcagcgcgggatgtcggttggtcg
ttggcgcggggccgcgcggcgttggagcaccgggccgtggtgctcggggagcggggcgcc
ggcgacgcccaggtcggtggggaccggctggccgggctgcgtgcgctggcggcggacgag
cccgtggagacggtggtgcgggggcgggttggcacaagtggtgatcgggtggtgtgggtg
tttccggggcagggggcgcagtgggtggggatgggcgcggagctgttggacgccttgccg
gtgtttgcgggtcgggtcgcggagtgcgcggcggcgttggcgccgttcgtggactggtcg
ctggtcgacgtcctgcggggggcctcggacgccccgggtgccgccgggatcgcgggtgtc
gaggggatcgtgggtgtcgagggcgcgggtttgctggagcgggttgatgtgctgcagccg
gtgtcgtgggcggtggcgttggggttggcggcggtgtgggagtcgtggggggtgcgcccg
gatgtggtggtggggcattcgcagggggagatcgttgcggcgtgtgtggcgggagtgctg
tccgtcgatgacggggcgcgggtggtggcggcccgtagtcgggtgattgcgggggagctg
gctgggtgcgggggcatggcgtctgtggcgctaccggtgggtgaggtggaggcgcggctg
cgggtgggggctggtcgggtggaggtggcggcggtgaacgggccgtcggcgacggtggtc
gccggtgagcctgcggcgttggacgatctgctttccgtttgggaggcggagggtgttcgg
gttcgtcggttgccggtggactatgcgtcgcatacggcgcaggtggaccgggtccgcgac
cgactcaccacggagctcgcgggcatcgctccgcgtgcggggactgccgagatgtggtcc
acggtcaccggctccccggtcgatcccgggcagctcgacggggagtactggttccggaac
ctgcggtcgaccgtccgcctgcacgaggtcgccgacgtgctggtgggcgaggggcaccgg
gtgttcgtggagatcagcccgcatccggtgctgactgcggcgatcaccgagacggccgag
gcggccggcgtcccggacgctgtggtcgtggggtcgctgcggcgcggcgacggcgggccg
gaccggctggcggcggccgcggcgcagctgtgggtgcgcggtgttccggtcgactgggcc
ccgctggtggccggcggccggcaggtggacctgccgacctaccccttccagcaccagcgg
tactggctgctgggcgacggccgcccggccggcggtgccgcatccggcggtggcgcggcc
ggtgggacggatcttgacgggctgcggtaccgcgtcggttggcatccgctcggtccggag
ccgtcgcgggccgccccggccgccgctaccggccgatggctgatggtcacgccgttcccg
gccgccgatgacgtaccgccgctcgctgccgacgccgtgcgcgccctggccgaggacggc
gcggagatcgtcagcgtcccggtcggccccgccgagctcacccgggagggcctcgccggg
cgcctgcgagccgtgaccggcgccggggagagcgacccgcggggcgtgctgtcgctgctc
gcgctgaccggcacggcacagcccgacgggcccccgcgcgccgacggcgctgacagcgct
gacagcgccgtgggcgctgacggtgccgtgggcacggttggtgccacagccaccctgcta
ctcgtccaggccctgggcgacgcggggatcggcgcgccgctgtggtgcctcacccgcggt
gccgtgtccgtcggcggcggtgacccggtgaccgacccggcgcaggcgcagacctggggg
ctggggcgggtggccgcgctggagcacccgtcccgctggggcggcctcgtcgacctgccc
gacacgctggacgggtccgcccggcgccggctggcagcggttctgcgtggcgcgaccgat
gaggaccaggtcgcgatccgggcgggcacggtcttcgcccgtcggctgctgcgcgcgccg
ctcggcgggaccgaacccgcccggcgctggcggccccgcggaaccgtgctggtcaccagc
accggaccgctcggcccccatctggccggatggctggccgagcggggagccgggcacgtc
gtgctcgccggatcgcaccgcgcggacgatcccgacatcgcggcgctgcgtcacggcgcg
ttcaccggggacgtccggctgaccgtggccacctgtgacctcgcggaccgggaggcgttg
gccgcggtcgtccgcgggcaggccgccgacggcgaggggatccgcgccgtcgtgcacacc
gccgcgctgctcgggctgcgcccgctggccgacacctcggtcaccgacctggccggcgcg
atcgccgccaaggccaccgcggccgactggctcgacgagctgttccccaccgacgacctc
gacgcgttcgtgctcttctcgtcggtcgtcggcgtgtggggcggcgcagaccacgccgcc
tacgccgcggccaacgcccacctggacgccctggccgagcggcggcgtgcccgcggcctg
ccggccacctcgatcgcctgggggctgtggcgtccgctggcggagagcggcagcgccggc
gccggcgccgcggcagccgaggaccccggcgtgcggcggcagcgggcacgggggctcggg
tacctcgagccggaccgcgccctcgatgccctgcggcaggtgctggaccacgacgagacc
cacatcgtcgtggcggagatcgactggacgcggttcatcccggtcttcacctcggcgggc
cgccgcccgctgttcgacacgctcgccgaggacgccggggctgctggtgaggcccggatg
tccggcgtcgcggacggcgccgcctccccggccgcgtccggaaccggctcgccgctggcc
cggagactcgccgcgctgcctccggccgagcgggaccgggccctggtcgagacggtccgc
acccgggcagcggccgtgctggggcactccgacgccaccgccgtggaggcgcaccgggcc
ttccgcgacctcggcttcgactcgctgacctccgtcgacctgcgtaacgggctcggcgcg
gcgctcggcctgcggctgccgtccacgctggtgttcgactacccgaccccgttgacgctg
gcggagttcctgcgggtggagatcaccggcggcgacgcggacgacgcgcccgccgccggc
gtcccgggcgctgtggcgtcccgcgaccggagcgggcacggcggtgagcacgacctgctg
gacgccgagccggtggcgatcgtggccatggcctgccggctgcccggtggcgtcgactcc
ccggaggacctgtggcggctgctggccgagggccgggacgcgatcggcgagttcccggcc
gaccggggctgggatctcgacgccctgcacgatcccgacccggagcggtccggcacctcc
tatgtgcgccacggcggcttcctggccggggtcgccgacttcgacgccgagttcttcggc
atcaacccccgcgaggccctggcgatggacccccagcagcggctgctgctggagctgtcg
tgggaggcggtggaacgcgcgggcatcgacccgtcgacgctgcgcggcaccccgggcggg
gtgttcgtcggcacgaacgtccaggactacggcccgcgcgcgctggccgccggggcggag
acggagggctacatcggcatcggcaacgcggcgagcgtcatgtccgggcgcatctcctac
accctggggttgcaggggccggcggtgaccgtcgacacggcctgctcgtcgtcgctggtg
gccctgcaccaggccgtccaggcgctgcggcggggggagtgctcgctggcgctggccggc
ggcgcggtcgtgatgtcctccccgctgatgtacgtcgagttcagccgtcagcgcgcgctg
tcaccggacggccgctgccgggccttcggtgcgggcggtgacggcaccggcctctccgag
ggcgtcggcctgctggtcctcgaacggctctccgacgcccgccgggcgggccgtccggtg
ctcgccgtcgtcgagggcacggcggtcaactcggacggcgcgtcgaacggactgagcgcg
ccgaacggcccggcgcagcagcgggtgatccgccaggcgctcgccgtcgccgggctgtcg
ccgtccgaggtggacgcggtggaggcgcacggcaccgggacgaagctcggcgaccccatc
gaggcgcaggccctcatcgccgcgtacggccgcgaccggccggccgggcggccgctgtgg
ctggggtcgctgaagtccaacatcgggcacacccaggcggcggccggcgtggccggtgtg
atcaagatggtgctggccatgcggtacggggtgctgccgcgcaccctgcacgccgacgag
cccaccccgcaggtcgactgggacggggccggcgtccggctgctgaccgatgaggtcgcg
tggccggcccgcccgctcccggacgccgccccggcggggcgggagcgggccggtgagcgc
ggaccgcggcgggccgcggtctccgcgttcggcatcagcggtacgaacgcgcacgtgatc
ctccgcgaggcccccgccaccgaggagccgcgggtcgggccggcgccgtcaccggcgtcg
tcgccgcggccggtgccgctgctggtgtcggcgcgcaccacggaggggctgcgcgcccag
gcccgccggctggccgcccacctcgacgaccgtcccggcccggccgccgcggatgtcgcg
ctggccaccgcggcgacccgggccgccttcgaccaccgcgcggtcgtggtcggcgccgac
cacgacgagctgcgggccggcctcgtggagctcgccggcgaccaggatcccgccgacggg
accgcccccgtgggcgtccgccagccgcgcggccttgtcgtgcgcggcgtggccgttccc
gacccgcgagtggtgttcgtcttccccgggcagggatcacagtggtccggcatgggccgg
gagctgctggagtcgtgcccgccgttccgcgagcggatgaccgagtgcgccgcggcgttc
gagccctacctcgactggtccctgctggacgtgatccgcggggccggtgacacgccgccg
ctggaggccatcgaggtgatccagcccgcgctgatgtcgatgatggtttcgctggccgcg
gcctggcgcgcctacggggtgacgccggccgcggtggtcggcaccagccagggggaggtc
gccgccgcgcacgtcgccggtgctctctccctggccgacgcggcccggatcatcgcgctg
cgcagcaggctgctggccacccgcctgctcggccggggcgcgctggcgtcggtcgggctg
ccgcccgcggacgtcgccgcccggctcgaccgcttcggcggccggctcgccgtcggcggg
atcaacgggccgcggcaggtcaccgtcgccggcgagaccggcgcactggacgacctggtc
gccgagctcaccgccgagggcgtccgcgcccggctggtcgcggcgtcggtcgcgacgcac
tgcgcgcaggtggacggcatccgtcccgagctgatggagatcctgcgcccactggctccc
acccccgcccggatcccggtctactcgacggtgaccggggggccgctggacgccgcggcg
ctggacgccgagtactggtactccaacacccgggaaccggtcctgctcgacggcgccgcg
cgggcgctgctggccgccggattcgacaccttcgtcgaggtcagcccgcatccggtggtg
ggattcgggctggccgagacggcgcacgacgccggccgggacgccgtggtcgtcagcacg
ctccagcgcggccgcgggggtgccgaccgcctgctggccgcgctggccgaggtgcacgtc
cacggggtcggcgtcgactggcgggaggcgttcgcgggcaccggcgcccacccggccgac
ctgcccacctacgccttccagcgtcggcggttctggccgcggccggcaccggcccgcccg
gccgacgccgccgccgcgccgggccgcgacggcccggctcatccgctggtcaccgccgcc
gtcccgatggccgacgggagcctgctgctgacggcccggatcagcccggccgcgcagccg
tggctggccggccggaccgtggccggtgtcccggtcgtgccggacggggtgctgctggaa
ctggccatccaagcgggcgacgaggtcggctgcccggaggtgaccgacctggccctgacc
gggccgctggtgctgccggagagtggggcgctccggctccagctgcacgcgggagcaccg
gacggcaccgggaaccgtgcgctgacggtgcatgcccgtaccgacggggccccggcggac
gcgccctggaccgcgcacgccaccgcgacgctggcgggcaccgccgacccggccgcgtcc
gtacccgacccgcgggcgtggccgccgcccggcgcggttccggtggacgtcgaccggctg
tacggcgagctgctcgccgccggtcacggccacgggccggacggcccgcggctgaccagg
gcctggcaggcggggacggacctgttcgccgaggccgtcctggacggcgagcacgaggtg
gccgggttcggcctgcacccggtgctgctcgaggtggccggccacctggccctgtgggga
cggctcccggcagccggcgccgagccgcccgcggagccgcccgccgtgctcggcgtggag
ccgcccgcggtgtcggagccggtggtggcggtcgacggcggctaccggggcgtgcggctg
tatgccaccggtgcgcgggcggtgcgggtgcgtgtcggccctgcgggcgccggcgcggtc
tcggtggagctggccgaccacaccggcgcggcggtcgcggcctacggctcgaccggcctc
cggccgctggccgccgcccggctgcgtgcgctgcgcacctcggcggcggactcgatgttc
gccctcgactgggtgccggtggcccccgcacgggcctcgggtgccggcgcgccgggctgg
gcggtgctcgggccggacccgctcgggctgcgcacggccctcgcgctggccggcgtccac
gccccggcctgcctggacctggcggcggccgcggccctgccggccatccccgacgtcgtg
ctggtgaccagcgactcggccgcggccggcccggatctcgcggcggccgcgcgaaccgcc
ctgcgctcggtgctcgccctggcgcaggaatggctgcgtgacgaccggttcgccgccgcc
cggctggtcgtggtcacccggggggcggtggcggtcggcgcgcacgacgacgtcaccagc
ctcgccgacgccgcggtgtggggcctgctcggctcggcggcggcggagaacccggaccgg
ttcctgctcgtggacgtcgacgggacgcctgcgtcggagcgggccctgccggccgcggtc
gcctgcggcgagccgcgggtcgccctgcgcgagggcgccgtcctgggccaacgcctggtc
cgcgcgccggtcgccggcgccggtgtcgacgccggccgggcacggtggcggccggacggg
acggtgctgatcaccggtggcaccggcacgctgggcgggctggtcgcccggcacctggtc
accggctacgggatcggcaacctgctgctggtcagccgcggcggagccggttcgcccggc
gtcgcggagctgaccgacgatctgacagccctgggcgcgcgggtgacggtggcggcctgc
gacgtcgccgaccgcgccgcgctggccggcgtgctcgccgcgatccccgcggcgcatccc
ctgacggcggtcgtgcacgccgccggtaccctcgacgacggggtgttctccgcgatgacc
ccggagcgcctcgacaccgtgctgcggcccaagatggacgccgccctgcacctgcacgag
ctcacccggggcgacgacctggccgccttcgtgctgttctcctcgtccgcggccgcgttc
ggcagcgcggggcaggcgaactacgcggccgccaacaccttcctcgacgccctggcgcac
caccggcgggcagccggcctgcccgcgctcgccctcggctgggggtactgggccccgcgc
agcgccctggccgggcacctcgacgccgccgcgctcgaccagcggatggccgccaacggg
ctgcggccgatctccgccgcggccggcatggcgctgttcgacgccgcgctcaccgcggac
cgccccgtgctgctgcccatgcggctcgacccgcgggcaccgcgggcgggggccgtcccg
gcgctgctgcgcggcctggtccgccacccggcccggcggtcggtcgacggcgcggccgat
gatccggtcgagacgctggcgcggcggctggcgggggccggcggcccggaacgggaccgg
gccctgctcgacgtcgtgtgcgccaccgccgccgcggcgttggggcacacgtccgcggcg
gaggtggcaccggaccggccgttccgggagctcggtttcgactcgctcgcctcggtgcag
ttccgcaaccggctgaccgcggccaccgggttgcgcctgcggccgatgctcgtcttcgac
ttcccgacacccgaggccatcgccggccacctccgcgaccagttgttcccggaggtggcc
ccggccgccgcgggcccacccaccgccgcgcccgcgcccgcgcccgcgggcccgtccgac
ccggaaccgccggccgcgcccggcggcggcgagccggccagcgcgttcgacgagatggac
gccgagacgctggtccggctggccctcggtgagggcacctga

DBGET integrated database retrieval system