KEGG   Frankia sp. EAN1pec: Franean1_6855Help
Entry
Franean1_6855     CDS       T00608                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
fre  Frankia sp. EAN1pec
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABW16189
RhizoBase: Franean1_6855
UniProt: A8L298
LinkDB All DBs
Position
8356823..8358304
Genome map
AA seq 493 aa AA seqDB search
MRDRLMYRDAFYINGTWAAPAGSGTLNVVSPSTEEIVGALPEATREDMDRAVRAARDAFE
NGPWPRMSAAERADILARAAEALRKHEAEIAQVTTDEMGCATSQAKAAQTGLVAPVFEYY
SELARSYEFERTVVAGDRGALVTQEPVGVVAAIVPWNAPVTLAAWKAAPALAAGCTVVLK
PAPEAPLSNFILADAMDEAGVPPGVVNVVPGGREVGEYLVTHPDVAKVAFTGSTAAGQRI
MSLCGEAVRRVSLELGGKSASILVDDADFDTVVPTVVRGGMHLSGQVCGAHTRVLVPRSR
YEKVLEIAAAAAAGVSVGDPHDPSVFVGPLVAERQRTRVEGYIEGAVRDGARVVAGGVRP
EHLPRGWYVAPTIIGDVDNNMRIAREEIFGPVLCFLPYDDIDDAVRIANDSQYGLSGGVW
SADPARGVEVARRIRTGSVAVNGAYPPFPLVPFGGFKQSGLGRELGPEGLAGFLETRSIG
LPAALVAASQPTP
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgaccggctgatgtacagggatgcgttctatatcaacgggacatgggccgcgccg
gccggctccgggactctgaacgtggtgtcgccctcgaccgaagagatcgtgggcgcgtta
cccgaagccacccgcgaggacatggacagggcggtccgcgccgcgcgcgacgccttcgag
aacggcccctggccacggatgtccgcggccgagcgagccgacatcctggcccgggccgcc
gaggccctgcgcaagcacgaagccgagatcgcccaggtcaccaccgacgagatgggctgc
gcgaccagccaggccaaggccgcccagaccggcctggtcgcccccgtcttcgagtactac
agcgagctggcccgcagctacgagttcgagcggaccgtggtggccggtgaccgcggcgcc
ctggtgacgcaggaaccggtcggcgtggtcgccgcgatcgttccctggaacgcgccggtc
acgctggccgcgtggaaggccgctccggcgctggccgccggctgcacggtcgtcctcaag
ccggcgcccgaggccccgctgagcaacttcatcctcgccgacgcgatggacgaggcgggt
gtgccgcccggcgtggtcaacgtcgtccccggcggccgcgaggtcggcgagtacctggtc
acccacccggacgtcgccaaggtcgcgttcaccgggtcgacggcggccggccagcggatc
atgagcctgtgcggcgaggccgtccggcgggtctccctcgagctgggcggcaagtcggcc
tcgatcctggtcgacgacgccgacttcgacaccgtcgtcccgactgtcgtgcgcggcggc
atgcacctctccggccaggtctgcggtgcgcacacccgcgtcctggtgccgcgctcgcgc
tacgagaaggtgctcgagatcgccgccgcggccgccgcgggcgtctcggtcggcgacccg
cacgacccctccgtcttcgtcggccccctagtcgccgagcggcagcggacgcgggtcgag
ggctacatcgagggcgcggtgcgcgacggcgcccgcgtggtcgccggcggcgtccgcccg
gagcacctgccgcggggctggtacgtcgccccgaccatcatcggcgacgtcgacaacaac
atgcggatcgcccgggaggagatcttcgggccggtcctctgcttcctcccctacgacgac
atcgacgacgcggtccgcatcgcgaacgactcccagtacgggctgtccggtggtgtgtgg
tcggccgacccggcacgcggcgtggaggtcgcccggcgcatccgcaccggcagcgtggcc
gtcaacggcgcctacccgccgttcccgctggtgcccttcggtgggttcaagcagtccggt
ctcggccgtgagctcggccccgagggcctggccggcttcctggagacccgcagcatcggt
cttcccgccgcgctcgtggcggcgtcccagccgaccccgtga

DBGET integrated database retrieval system