KEGG   Francisella sp. FSC1006: LO80_05495Help
Entry
LO80_05495        CDS       T03403                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
frf  Francisella sp. FSC1006
Brite
Enzymes [BR:frf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LO80_05495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DevR Rb_C
Motif
Other DBs
NCBI-ProteinID: AIT09473
UniProt: A0A097EPH6
LinkDB All DBs
Position
complement(1107398..1107976)
Genome map
AA seq 192 aa AA seqDB search
MKFELPKLPYSTDALEPVISKETIEYHYGKHHQTYVTNLNALVEGTEHDGQNLEEVIKTS
SGGMFNNAAQVYNHTFYWNCLTPNKTEPTSQLKAAIFEAFGSMEKFQEDFSKAAVTTFGS
GWAWLVKNSEGKLEIVTTSNAGCPLTDNKKPLLTFDVWEHAYYIDYRNARPKYVEALWSL
VNWEFVSEQFAK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaactaccaaaattaccatatagcacagacgcattagagccagtgatttca
aaagaaacaattgaatatcattatggtaaacatcatcaaacatatgtgactaatttaaat
gccttagttgaaggtactgagcatgatggtcagaacttagaagaagttattaagacatct
tcaggtggtatgtttaataatgctgcacaagtttataatcatactttttactggaattgc
ttaactccaaataaaacagagcctacaagccagctaaaagctgctatttttgaagctttt
ggttctatggaaaaattccaagaagatttttcaaaagcggctgttacaactttcggttct
ggctgggcttggctagttaaaaattctgagggtaaattagaaattgtaactactagtaat
gctggttgcccgttaactgataataaaaagccactacttacatttgatgtgtgggagcat
gcttattatattgattatcgtaatgctagacctaagtatgttgaggctttgtggagtctt
gtaaactgggaatttgtttctgaacagtttgctaaataa

DBGET integrated database retrieval system