KEGG   Francisella sp. FSC1006: LO80_07005Help
Entry
LO80_07005        CDS       T03403                                 

Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
frf  Francisella sp. FSC1006
Pathway
frf00473  D-Alanine metabolism
frf00550  Peptidoglycan biosynthesis
frf01100  Metabolic pathways
frf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:frf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LO80_07005
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LO80_07005
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LO80_07005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:frf01011]
    LO80_07005
Enzymes [BR:frf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LO80_07005
Peptidoglycan biosynthesis and degradation proteins [BR:frf01011]
 Precursor biosynthesis
  Amino acid ligase
   LO80_07005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 RimK ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AIT09736
UniProt: A0A097EQB5
LinkDB All DBs
Position
1426401..1427288
Genome map
AA seq 295 aa AA seqDB search
MSKEKIVVLYGGDSPEREVSLKSGKVVLDSLINQGYDAVGLDASGRDLVASLIELNPDKC
FVALHGEDGENGRVSAVLEMLGIKHTGSSMKSSVITMDKMISKEIWMHHRMPTPIAKILT
DKLVSEDEISFPVAVKPSSGGSSIATFKVNTINELESAYSEASKYGDVMVEQWVTGKEIT
VAVVNDEVYSSVWIEPLNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC
KGHARVDFIYDNGEFYLMEINSSPGMTENSLSPKSAAAEGIDFDAFVKSIIEQAQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaaaaatagtagttttatatggtggagattctcctgagagagaagtttct
ttaaagtctggcaaagttgttttagactcactaataaatcaaggttatgatgctgttggt
ttagatgctagcggtagagatctagttgcaagtctgatagagctgaaccctgacaagtgt
tttgttgcattacatggagaagatggtgaaaatggtagagtatctgctgtgttagaaatg
cttgggattaaacacacaggttcgagcatgaaatcatcggtgataactatggataaaatg
atctctaaagagatatggatgcatcatcgtatgcctacacctatagctaagatattaaca
gataagcttgttagtgaagatgaaattagttttcctgtagcagttaaaccaagtagtggt
ggttcaagcatagcaacttttaaagttaatactattaatgagctagagtctgcatatagt
gaggcatcaaaatatggcgatgtaatggttgagcagtgggttactggtaaagaaataaca
gtagcagttgtgaatgatgaagtttattcatctgtatggattgagccattaaatgaattt
tatgactatgagtcaaaatatagtggtaaatctatttaccactctccaagtgggctgtgt
gagcaaaaagagttagaagttcgccagctagctaaaaaagcatatgatcttttaggctgt
aaaggccatgcaagagtcgactttatctatgataatggtgagttttatttgatggagata
aattcttctccaggaatgacggaaaatagtttatcaccaaaatcagctgctgctgaagga
atagattttgacgcttttgttaaatcgataatagaacaggcgcaatga

DBGET integrated database retrieval system