KEGG   Francisella sp. FSC1006: LO80_08295Help
Entry
LO80_08295        CDS       T03403                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
frf  Francisella sp. FSC1006
Pathway
frf00330  Arginine and proline metabolism
frf01100  Metabolic pathways
frf01110  Biosynthesis of secondary metabolites
frf01130  Biosynthesis of antibiotics
frf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:frf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LO80_08295
Enzymes [BR:frf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     LO80_08295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH NAD_Gly3P_dh_N ApbA GFO_IDH_MocA UDPG_MGDP_dh_C Sacchrp_dh_NADP PDH OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: AIT09966
UniProt: A0A097EQX2
LinkDB All DBs
Position
1684412..1685245
Genome map
AA seq 277 aa AA seqDB search
MQISFIGGGNMAAAMIAGMVAHGYDSKSILVFDRNKEKKNALVEKYGICVSDSISSTVKG
ADILILAIKPQNMVELINDIKALVNKDQIIVTVAAGIETQAYEKLFAKEISFVRTIPNTP
SSLGYGATGIYFNNNVSDDRKNKIIDIMKTMGEVAVVNDEREIDVIAAIASSGPAYYFQF
MEHMIEAAVNNGLDKSKAEKLVMQTCLGAAKMAQNSNEDISTLRKNVTSKKGITYEALNT
FESLGLDSIVNNAIQANIKRAKELSKEFSEAIDKSSF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataagttttattggtggtggtaatatggctgctgctatgattgctggaatggtt
gctcatgggtatgattcaaaaagtattctagtttttgatagaaacaaagaaaagaaaaat
gctcttgttgagaagtatggaatatgtgtttctgattcaatatctagtactgttaaaggt
gcagacattttaattttggcaattaagcctcaaaatatggttgaacttattaatgatata
aaagctcttgttaacaaagatcaaattattgttacagttgctgctggaattgaaactcaa
gcatatgaaaagctttttgcaaaagagatatcttttgtaagaacgataccaaatactccg
agtagtctaggatacggggcgacaggtatatattttaataataatgtaagtgatgataga
aaaaacaagataatagatattatgaagacaatgggagaagttgctgttgttaatgatgaa
cgtgagatagatgttattgctgctattgcaagctcaggtccagcttactatttccaattt
atggagcacatgatagaagctgctgtaaataatggtttagataaatctaaagctgaaaag
ctagttatgcaaacttgtttaggggctgcaaaaatggcacaaaatagtaatgaggatata
tcaacgttaagaaaaaatgttacttctaaaaaaggtataacgtatgaagctttaaatacg
tttgaatctttagggcttgatagtattgtaaataatgcaatacaagcaaatataaaaaga
gctaaagaactatcaaaagagtttagtgaagctatagataaatcaagcttttag

DBGET integrated database retrieval system