KEGG   Francisella sp. FSC1006: LO80_08450Help
Entry
LO80_08450        CDS       T03403                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
frf  Francisella sp. FSC1006
Pathway
frf00071  Fatty acid degradation
frf00280  Valine, leucine and isoleucine degradation
frf00281  Geraniol degradation
frf00362  Benzoate degradation
frf00592  alpha-Linolenic acid metabolism
frf01100  Metabolic pathways
frf01110  Biosynthesis of secondary metabolites
frf01120  Microbial metabolism in diverse environments
frf01130  Biosynthesis of antibiotics
frf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:frf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LO80_08450
   00592 alpha-Linolenic acid metabolism
    LO80_08450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LO80_08450
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    LO80_08450
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LO80_08450
   00642 Ethylbenzene degradation
    LO80_08450
Enzymes [BR:frf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     LO80_08450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA DUF2774
Motif
Other DBs
NCBI-ProteinID: AIT09996
UniProt: A0A097EQZ5
LinkDB All DBs
Position
complement(1714055..1715242)
Genome map
AA seq 395 aa AA seqDB search
MSENVYIVAAKRSAVTKAKRGGFAKKRPDELLADVLKQTVAESGVNPEDIGDIVVGCAMP
EAEQGMNVARISTLLAGLPDKVPAFTINRYCSSGLQSIAIAANEIAQGNMDVAIGAGIES
MSMIPMGGNKISFSKEVFAKDENVAIAYGMGITAENVAKDWDVSRQAQDEFALKSHQKAI
TAIENGYFDNEILDINVDHQLPDEENNKIVNHKKIISKDEGARSDTSLEALAKLKPAFAA
KGSVTAGNSSQVSDGSGAVVLVSESYLKKHNLKPLGKFLGFAVAGVDPRIMGIGPVEAIP
KVLKQTGLTIEDMDWIELNEAFAAQSIAVINDLKLDETKVNPCGGAIALGHPLGATGTIL
TVKALHGLHRTDKKYAMITMCIGTGMGAAGIIEAC
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaatgtctatatagtagctgcaaaacgctcagcggtaacaaaagctaaacga
ggtggttttgcaaaaaaacgccctgatgaattacttgctgatgtactaaaacaaactgta
gcagaatcaggagttaatcctgaagatattggcgatattgtagttggttgtgctatgcca
gaagccgagcaaggtatgaatgttgcaaggatatcaaccctactagcaggcttaccagat
aaagtaccagcctttacaatcaatcgttactgtagttctggattacaatcaatagcaatt
gcagcaaatgaaatagctcaaggtaatatggatgtagctattggagctggtatcgagagt
atgagtatgatccctatgggtggtaataaaatttctttttctaaagaggtttttgctaaa
gatgaaaatgtagctattgcctatggtatgggaatcacagctgaaaatgtagctaaagat
tgggatgtctctcgtcaagcacaagatgaatttgctcttaaaagccatcaaaaagctata
acagcaattgaaaacggttattttgataatgaaattttagatattaatgttgatcaccag
cttcctgatgaggaaaataacaaaatagtaaaccacaaaaaaatcatctcaaaagatgaa
ggtgcaagatctgacacatctctagaggcgttagctaaactaaaacctgcttttgcagct
aaaggctctgttaccgcaggtaatagctctcaagtctctgatggttctggtgctgttgta
ctagtaagtgagtcatatttgaaaaaacacaatctaaaacctttaggtaagtttttagga
tttgctgtagctggagttgaccctcgtattatgggtataggtcctgttgaagctattcca
aaagtgcttaagcaaacaggcttaactattgaagatatggattggattgagcttaatgag
gcttttgctgctcagtctatagctgttattaatgacttaaaacttgatgaaactaaagta
aacccttgtggtggagctattgcacttggacaccctcttggtgcaactggtactatactt
acagttaaggcattgcatggtttgcatcgtactgacaaaaaatatgctatgattacgatg
tgtattggtactggtatgggcgctgcgggtattattgaggcttgttaa

DBGET integrated database retrieval system