KEGG   Frankia inefficax: FraEuI1c_0631Help
Entry
FraEuI1c_0631     CDS       T01354                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fri  Frankia inefficax
Pathway
fri00521  Streptomycin biosynthesis
fri00523  Polyketide sugar unit biosynthesis
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01130  Biosynthesis of antibiotics
Module
fri_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    FraEuI1c_0631
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FraEuI1c_0631
Enzymes [BR:fri01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     FraEuI1c_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADP78709
UniProt: E3JCL3
LinkDB All DBs
Position
792498..793046
Genome map
AA seq 182 aa AA seqDB search
MIIAPAGLDGVFIVDIEPFSDDRGLFARTFCREEFAAAGLDVDVAQCSVAYNRRAGTVRG
LHWAGAPVQETKLVRVTRGALLDVVVDTRPGSPTFLRHVAVELSADNHRALFIGAGLAHG
YQTLVDDTEASYQMNVPFRPGFDRGLRHDDPALGIAWPLPVSVISDKDRAWPLLGEADMI
AV
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatcgcgccggccgggctcgacggggtgttcatcgtcgatatcgagccgttctcc
gacgatcgcggactgttcgcccggacgttctgccgtgaggagttcgccgccgcggggctc
gacgtcgacgtcgcccagtgcagcgtcgcctacaacaggcgggccggcacggtccgcggc
ctgcactgggccggcgcgccggtccaggagaccaagctggtccgggtcaccaggggcgcg
ctgctggacgtggtggtcgacacccggcctggctcgccgaccttcctgcgccacgtcgcc
gtcgagctgtcagcggacaaccaccgggcgctgttcatcggcgcgggactggcccacggc
taccagaccctcgtcgacgacaccgaggccagctaccagatgaacgtccccttccggccg
ggcttcgaccggggcctgcgccacgacgacccggcgctcgggatcgcgtggccactgccg
gtatcggtgatctcggacaaggaccgggcctggcccctcctaggtgaagccgacatgatc
gccgtttga

KEGG   Frankia inefficax: FraEuI1c_0813Help
Entry
FraEuI1c_0813     CDS       T01354                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fri  Frankia inefficax
Pathway
fri00521  Streptomycin biosynthesis
fri00523  Polyketide sugar unit biosynthesis
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01130  Biosynthesis of antibiotics
Module
fri_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    FraEuI1c_0813
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FraEuI1c_0813
Enzymes [BR:fri01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     FraEuI1c_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADP78891
UniProt: E3IV11
LinkDB All DBs
Position
complement(1012562..1013179)
Genome map
AA seq 205 aa AA seqDB search
MDVTELSVPDAWVFTPRQHTDSRGTFLEWFRADALEKALGHPLGLAQGNHSISRAGTLRG
VHYADVPPSQAKYVTCVSGRVLDCVIDIRVGSPTFGQWAAVQLDDVDRKGIYLAEGLGHA
FIALTDGAQVSYLCSTPYTPGRERGINPLDPDLGLPWPADLTPLLSDKDAVAPTLKEAEA
AGLLPSYAACQAFYADLRSQAGFGQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtcaccgaactgtccgtaccggacgcgtgggtcttcaccccacgacagcacacc
gacagccgcggcaccttcctcgagtggttccgcgccgacgcgctggagaaggccctgggc
cacccgctggggctggcccagggcaaccacagcatcagcagggcggggacgctgcgcggg
gtgcactacgcagacgtgccaccgagccaggcgaaatacgtcacctgtgtgtccggccgg
gtgctggactgtgtgatcgacatccgggtcggctcgccgacgttcggccagtgggccgcc
gtccagctcgatgacgtcgaccgcaaggggatctacctcgcggaaggcctcgggcacgcg
ttcatcgcgctgaccgacggcgcgcaggtctcctacctgtgttcaacgccatacaccccc
ggtcgggagcgcggcatcaacccgctcgaccccgacctcgggctgccctggccggcggac
ctgaccccgctgctgtcggacaaggacgccgtcgcccccaccctcaaggaggccgaggcc
gccgggctgctgccgtcgtacgccgcctgccaggcgttctacgccgacctgcgcagccag
gccggcttcggccagtaa

DBGET integrated database retrieval system