KEGG   Frankia sp. EuI1c: FraEuI1c_0811Help
Entry
FraEuI1c_0811     CDS       T01354                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
fri  Frankia sp. EuI1c
Brite
KEGG Orthology (KO) [BR:fri00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FraEuI1c_0811
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FraEuI1c_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni DUF2937
Motif
Other DBs
NCBI-ProteinID: ADP78889
UniProt: E3IV09
LinkDB All DBs
Position
complement(1011701..1012099)
Genome map
AA seq 132 aa AA seqDB search
MSLLHPKTQVSAHCDLPCGVYDPAQARIEAQSVKAIQEKYQGNEDPVFRARALSIKEERA
DLVKHHLWVLWTDYFKPNHLEKYPELHDLFWQATKAAGAAGAKGSVDPADGQKLIDKIDE
IAKVFWETKAAA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctgcatcccaagacccaggtgagcgcgcactgcgacctcccctgcggcgtc
tacgacccggcgcaggcccggatcgaggcccagtcggtcaaggcgatccaggagaagtac
cagggcaacgaggacccggtcttccgggcgcgtgcgctctccatcaaggaggagcgggcc
gacctggtcaagcaccacctgtgggtgctgtggaccgactacttcaagccgaaccacctg
gagaagtacccggagctgcacgacctgttctggcaggccaccaaggccgccggcgcggcg
ggcgccaagggctcggtcgacccggccgacggccagaagctgatcgacaagatcgacgag
atcgccaaggtcttctgggagaccaaggccgctgcctga

DBGET integrated database retrieval system