KEGG   Frankia inefficax: FraEuI1c_1184Help
Entry
FraEuI1c_1184     CDS       T01354                                 

Definition
(GenBank) carboxyl transferase
  KO
K18472  acetyl-CoA/propionyl-CoA carboxylase carboxyl transferase subunit [EC:6.4.1.2 6.4.1.3 2.1.3.15]
Organism
fri  Frankia inefficax
Pathway
fri00061  Fatty acid biosynthesis
fri00280  Valine, leucine and isoleucine degradation
fri00620  Pyruvate metabolism
fri00630  Glyoxylate and dicarboxylate metabolism
fri00640  Propanoate metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01200  Carbon metabolism
fri01212  Fatty acid metabolism
Module
fri_M00082  Fatty acid biosynthesis, initiation
fri_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FraEuI1c_1184
   00630 Glyoxylate and dicarboxylate metabolism
    FraEuI1c_1184
   00640 Propanoate metabolism
    FraEuI1c_1184
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FraEuI1c_1184
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FraEuI1c_1184
Enzymes [BR:fri01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     FraEuI1c_1184
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     FraEuI1c_1184
    6.4.1.3  propionyl-CoA carboxylase
     FraEuI1c_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE
Motif
Other DBs
NCBI-ProteinID: ADP79256
UniProt: E3J178
LinkDB All DBs
Position
complement(1490938..1492341)
Genome map
AA seq 467 aa AA seqDB search
MSLSTLELVDPRSPVARLNRFFDADSVNLFAAPDSSGVVAGQGLVDGNEVVAFASDATVQ
GGAMGRDGCARIVHAIESAARMGVPVVGIWHSGGARLQEGVSSLDGMGRVFSAIVRASGR
IPQISLVLGAAAGGAAYGPALTDLVIMGPDGKVFVTGPDVVRSVTGEDCTFDSLGGPTIH
STKSGVVHMTCDSDDQAYETTRHVVGLLADQGDIGEVEPRELAQFLPESPRRAYDVRPLV
GGLVDDGFVEIHPRWARNIVTALGRLGGRTVGVIANNPLRRGGCLDSLSAEKAARFVRLC
DSFGVPLVVLVDTPGYLPGVGQEWEGVVRRGAKLLYAFAEATVPRVTVMTRKAYGGAYIA
MNSASLGATAVYAWPTAEVAVMGHEAAVKIIHRRTIAAVPEQRQPDKIKELAEEHAVTVG
GVDKAVELGVVDAVVEPGDTRTVVAAAIAEALAAGRPDKNVHGNIPL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctgtccacgttggaactcgtcgaccctcgctcccccgtcgcccggctgaaccgc
ttcttcgatgccgacagcgtcaacctgttcgccgcgcccgacagctcgggtgtcgtcgcc
gggcagggactggtcgacggcaacgaggtggtcgcgttcgccagcgacgcgacggtgcag
ggcggggcgatgggccgcgacggctgtgcgcgcatcgtgcacgccatcgagtcggcggcc
cggatgggcgtcccggtggtcggcatctggcactcgggcggcgcgcggctgcaggagggc
gtctcgtcgctcgacggcatgggccgcgtgttctccgcgatcgtgcgggcgtcgggccgg
atcccccagatctcgctggtgctgggcgcggccgccggtggcgccgcctacggcccggcg
ctgaccgacctggtcatcatgggtccggacggcaaggtcttcgtcaccggtcctgacgtc
gtccgctcggtgaccggggaggactgcacgttcgacagcctcggcggcccgacgatccac
tccaccaagagtggcgtcgtccacatgacctgcgactccgacgaccaggcgtacgagacg
acgcgccacgtcgtcggcctgctggccgaccagggtgacatcggcgaggtcgagccgcgc
gagctcgcccagttcctgcccgagtcgccccggcgcgcctacgacgtgcgcccgctggtc
ggcgggctggtcgacgacggtttcgtcgagatccacccccggtgggcccgcaacatcgtg
accgcgctgggccgcctcggcggccggacggtcggcgtcatcgccaacaacccgttgcgc
cgcggtggctgcctcgactcgctgtcggcggagaaggcggcccgcttcgtgcggctgtgc
gactccttcggggtgccgctggtcgtcctcgtcgacacgcccgggtacctgcccggcgtc
ggccaggaatgggagggcgtcgtccgccgcggggccaagctgctctacgccttcgccgag
gcgaccgtgccgcgggtgacggtgatgacccgcaaggcctacggcggcgcctacatcgcg
atgaactccgcctccctgggcgccacggccgtctacgcctggccgaccgccgaggtcgcc
gtcatgggccacgaggcggccgtgaagatcattcaccgccgcacgatcgccgcggtcccc
gagcagcgccagcccgacaagatcaaggagctggccgaggagcacgcagtcaccgtcggc
ggcgtcgacaaggccgtcgagctcggcgtggtcgacgcggtcgtcgagccgggcgacacc
cgcaccgtggtggccgccgccatcgccgaagccctcgccgccggccgccccgacaagaac
gtccacggcaacatcccgctgtaa

KEGG   Frankia inefficax: FraEuI1c_1633Help
Entry
FraEuI1c_1633     CDS       T01354                                 

Definition
(GenBank) Carbamoyl-phosphate synthase L chain ATP-binding protein
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
fri  Frankia inefficax
Pathway
fri00061  Fatty acid biosynthesis
fri00280  Valine, leucine and isoleucine degradation
fri00620  Pyruvate metabolism
fri00630  Glyoxylate and dicarboxylate metabolism
fri00640  Propanoate metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01200  Carbon metabolism
fri01212  Fatty acid metabolism
Module
fri_M00082  Fatty acid biosynthesis, initiation
fri_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FraEuI1c_1633
   00630 Glyoxylate and dicarboxylate metabolism
    FraEuI1c_1633
   00640 Propanoate metabolism
    FraEuI1c_1633
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FraEuI1c_1633
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FraEuI1c_1633
Enzymes [BR:fri01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     FraEuI1c_1633
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     FraEuI1c_1633
    6.4.1.3  propionyl-CoA carboxylase
     FraEuI1c_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATP-grasp Biotin_lipoyl_2 ATP-grasp_3 RnfC_N GCV_H ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ADP79691
UniProt: E3J8V8
LinkDB All DBs
Position
complement(2005979..2008135)
Genome map
AA seq 718 aa AA seqDB search
MFDTVLVANRGEIAVRVIRSLRALGIRSVAVYSDADAGARHVREADVAVRIGPAPARESY
LNTTAVLAAAWATGAQAIHPGYGFLSENAAFAAACAEQGIVFVGPPAHAVEVMGDKITAK
KAMVAAGVPVVPGRAEPGLDAAALAEAAEEIGFPVLLKPSAGGGGKGMRIVRAAAEMADA
VASARREAAGAFGDDTLFLERYVDSPRHIEVQVLADAHGNVIHLGERECSLQRRHQKIIE
EAPSALLTALPDGGAVRERIGQAAVTAAAAVGYVGAGTVEFIVAGDEPETFYFLEMNTRL
QVEHPVTELVTGLDLVAEQLRVAAGEPLRVRQQDVTLTGHAVEARVYAEDPGRGFLPTGG
EILALTEPTGEGVRVDSGVAAGTVVGSDYDPMLSKVIAWAPERAGALRRLDAALGHTVLL
GVTTNIGFLRTLLANGDVRAGRLDTGLVERHLAELTAAPAPEGTASQGTASQGTASEGTA
SEGSAAPGTASRGSAENTSAEVGGVGPPADALAVYGLAQLLRLQPAGPVIDPWDVPSGWR
VGEDTWLRWTLDLGAGARPSVEVRGTPAAAAVRIDGRAPIAAAARRVESPAGTELLVTLD
GVTSRWRLADGPDGTLWVGAGGAAWPLGEWVREPGAVAAAAGDGQARSPMPGTVIAVDVA
AGDSVAAGQRLAVVEAMKMEHAITAPVAGLVKDVLVAVGARVALDALLAVVEPVADPT
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaccgtgctcgtcgcgaaccggggggagatcgccgtccgggtcatccggagc
ctgcgggcgctggggatccggtcggtcgcggtctactcggacgccgacgcaggcgcccgg
cacgtgcgggaggcggatgtcgcggtccggatcgggccggcgcccgcccgcgagtcgtac
ctgaacacgaccgccgtgctcgccgccgcctgggcgacgggggcgcaggcgatacacccc
ggctacggcttcctgtcggagaacgcggcgttcgccgcggcctgcgccgagcaggggatc
gtcttcgtcgggccgccggcccacgccgtcgaggtgatgggcgacaagatcaccgcgaag
aaggcgatggtggcggccggggtgccggtcgtgcccggccgggccgagcccggcctggac
gcggcggcgctggcggaggcggccgaggagatcgggttcccggtactgctcaagccgtcc
gccggtggcggcggcaagggcatgcggatcgtgcgcgcggcggccgagatggccgacgcg
gtggcctcggcccgccgggaggccgcgggcgcgttcggcgacgacacactgttcctcgag
cgctacgtcgacagtccgcgccacatcgaggtccaggtcctcgccgacgcccacggcaac
gtcatccacctcggtgagcgcgagtgctcgctgcagcgacgccaccagaagatcatcgaa
gaggcgccctcggcgctgctcacggcgctccccgacggcggtgccgtgcgggagcggatc
ggccaggccgccgtcaccgcggcggccgcggtcggctacgtcggtgccgggaccgtcgag
ttcatcgtcgcgggcgacgagcccgagaccttctacttcctggagatgaacacccgcctg
caggtcgagcacccggtgaccgagctcgtcaccggcctcgacctggtcgccgagcagctg
cgggtcgccgccggcgagccgctgcgggtgcgccagcaggacgtgacgctcaccgggcac
gcggtcgaggcccgcgtctacgcggaggacccgggccggggcttcctgccgaccggcggc
gagatcctggccctgaccgagccgacgggtgagggtgtccgggtcgactcgggcgtcgcc
gccggcacggtcgtcggctcggactacgacccgatgctgtcgaaggtgatcgcctgggcg
ccggagcgggccggcgcgctgcgccgcctggacgcggcgctcgggcacaccgtgctgctc
ggcgtcacgacgaacatcggcttcctgcggacgctgctcgcgaacggggacgtgcgcgcg
ggccggctggacaccggcctggtggagcgtcatctcgccgagctgacggccgccccggcg
ccggagggcacggcgtcacagggcacggcgtcacagggcacggcgtcggagggcacggcg
tcggagggctcagcggcgccgggcacggcgtcgcggggctcggccgagaacacctcggcc
gaagtcggcggggtcgggccgccggcggacgcgctcgccgtctacgggttggcccagctg
ctgcggctgcagccggccggtccggtcatcgacccgtgggacgtgccgtccggctggcgg
gtcggcgaggacacctggctgcgctggaccctcgacctgggtgccggcgcccggcccagc
gtggaggtacggggcacgcccgcggcggcggcggtgcggatcgacgggcgggcgccgatc
gccgcggccgcccgccgcgtcgagagccccgccggcaccgagctgctcgtcaccctcgac
ggcgtcacgtcgcgctggcggctcgccgacggtccggacggcacgctgtgggtcggggcc
ggcggcgccgcctggccgctgggcgagtgggtccgcgagccgggcgcggtcgcggcagcg
gccggcgacgggcaggcacgcagcccgatgcccggcacggtgatcgcggtcgacgtcgcg
gccggggactccgtcgccgccggccagcggctcgcggtcgtggaggcgatgaagatggag
cacgcgatcacggcaccggtcgccggactggtgaaggacgtgctggtcgccgtcggcgcc
cgggtcgccctggacgcactgctcgccgtcgtcgagccggtcgccgacccgacctga

KEGG   Frankia inefficax: FraEuI1c_6121Help
Entry
FraEuI1c_6121     CDS       T01354                                 

Definition
(GenBank) Carbamoyl-phosphate synthase L chain ATP-binding protein
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
fri  Frankia inefficax
Pathway
fri00061  Fatty acid biosynthesis
fri00280  Valine, leucine and isoleucine degradation
fri00620  Pyruvate metabolism
fri00630  Glyoxylate and dicarboxylate metabolism
fri00640  Propanoate metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01200  Carbon metabolism
fri01212  Fatty acid metabolism
Module
fri_M00082  Fatty acid biosynthesis, initiation
fri_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FraEuI1c_6121
   00630 Glyoxylate and dicarboxylate metabolism
    FraEuI1c_6121
   00640 Propanoate metabolism
    FraEuI1c_6121
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FraEuI1c_6121
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FraEuI1c_6121
Enzymes [BR:fri01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     FraEuI1c_6121
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     FraEuI1c_6121
    6.4.1.3  propionyl-CoA carboxylase
     FraEuI1c_6121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_3 HlyD_D23 LAL_C2 LpxI_N
Motif
Other DBs
NCBI-ProteinID: ADP84105
UniProt: E3J200
LinkDB All DBs
Position
7545657..7547426
Genome map
AA seq 589 aa AA seqDB search
MRKILIANRGEIAVRVARACKDAGYASVAVYAEPDIDALHVRVADEAYALGGSTPGDSYL
RIDKILDAIAKSGADAVHPGYGFLSENADFAEAVIAAGLTWIGPSPDAIRRLGDKTQARH
IALAVGAPLAPGTADPVAGVDEVIAFADEFGLPVAIKAAFGGGGRGLKVAWTRDELPELF
ESAVREAVAAFGRGECFVERYLDQPRHVETQILADTHGNVVVVGTRDCSLQRRYQKLVEE
APAPFLTDAQRASLYEASKKIAKEAGYIGAGTCEFLVAKDGLISFLEVNTRLQVEHPVTE
ETTGIDLVREQFRIAEGEALGFTDPPARGHSIEFRINGEDPGRKFLPAPGTVTKLVLPTG
PGVRIDAGIESGSVIGGAFDSLLAKVIVTGSTRQQALERARRVLDELVVEGMATALPFHR
AVVRDPAFAPASADEAFTIHNRWIETEFNNTIPAFTGGADAEDAEAGPRETVVVEVGGKR
LEVVLPAGLGASSGGSGGGGRGPAPKRKASGKKAGAATGNSLTSPMQGTIVKVGVADGDV
VAEGDLIVVLEAMKMEQPITAHRAGTVTGLTATVGAVVPSGTVLCEIKD
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaagatcctcatcgccaaccgcggcgagatcgccgttcgggtggcgcgggcctgc
aaggacgccggctacgccagcgtcgcggtctatgccgagcccgacatcgacgccctgcac
gttcgcgtagccgatgaggcgtacgcactcggcggctccacccccggcgactcgtacctg
cggatcgacaagatcctcgacgcgatcgcgaagtcgggggccgacgcggtccaccccggc
tacggcttcctgtcggagaacgccgacttcgccgaggccgtcatcgccgccgggctgacc
tggatcggcccgtcgccggacgcgatccgccggctgggcgacaagacccaggcccggcac
atcgcgctcgccgtcggcgccccgctcgcgccgggcaccgccgacccggtggccggcgtc
gacgaggtcatcgccttcgccgacgagttcggcctgcccgtcgccatcaaggcggcgttc
ggtggcggtggccgtggcctgaaggtcgcctggacgcgggacgagctgcccgagctgttc
gagagcgcggtccgcgaggccgtcgccgcgttcggccggggcgagtgcttcgtcgagcgt
tacctcgaccagccgcgccacgtcgagacccagatcctcgccgacacccacggcaacgtg
gtcgtcgtcggcacccgcgactgctcgctgcagcggcgctaccagaagctggtcgaggag
gcgcccgcgccgttcctcaccgacgcgcagcgtgcctcgctgtacgaggcctccaagaag
atcgccaaggaggccggctacatcggggccggcacctgcgagttcctggtcgccaaggac
gggctgatcagcttcctcgaggtcaacacccggctgcaggtcgagcacccggtgaccgag
gagacgaccggcatcgacctggtgcgtgagcagttccgcatcgccgagggtgaggcgctc
ggcttcaccgacccgcccgcgcgcggtcactcgatcgagttccggatcaacggcgaggac
ccgggccgcaagttcctgcccgcgccgggcaccgtcacgaagctcgtgctgccgaccggt
cccggcgtgcgcatcgacgccggcatcgagagcggcagcgtcatcggcggggccttcgac
tcgctgctggccaaggtgatcgtcaccggctcgacccggcagcaggcccttgagcgggcc
cgccgggtgctggacgagctggtcgtcgagggcatggcgacggcgctgccgttccaccgc
gcggtggtccgggacccggcgttcgccccggcctccgccgacgaggccttcacgatccac
aaccgctggatcgagaccgagttcaacaacaccatccccgccttcaccggcggcgccgac
gccgaggacgccgaggccggcccgcgcgagacggtcgtcgtcgaggtcggtggcaagcgg
ctggaggtcgtgctgccggccggcctcggggcgtcgagcggtggctcgggcggcggcggg
cgtggcccggcgccgaagcgcaaggccagcggcaagaaggccggcgccgcgaccggcaac
tcgctgaccagcccgatgcagggcaccatcgtcaaggtcggcgtcgcggacggcgacgtg
gtggccgaaggcgacctgatcgtcgtcctcgaggcgatgaagatggagcagccgatcacc
gcgcaccgcgcgggcaccgtcaccggcctgaccgccaccgtcggcgccgtcgtccccagc
ggcaccgtcctctgcgagatcaaggactga

KEGG   Frankia inefficax: FraEuI1c_6163Help
Entry
FraEuI1c_6163     CDS       T01354                                 

Definition
(GenBank) carboxyl transferase
  KO
K04104  acyl-CoA carboxylase subunit beta [EC:6.4.1.-]
Organism
fri  Frankia inefficax
Pathway
fri00620  Pyruvate metabolism
fri00640  Propanoate metabolism
fri01200  Carbon metabolism
fri01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FraEuI1c_6163
   00640 Propanoate metabolism
    FraEuI1c_6163
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FraEuI1c_6163
Enzymes [BR:fri01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.-  
     FraEuI1c_6163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans
Motif
Other DBs
NCBI-ProteinID: ADP84147
UniProt: E3J242
LinkDB All DBs
Position
7599387..7600883
Genome map
AA seq 498 aa AA seqDB search
MTDRHPTSADLHAERGEQARPDPAQDRPRAPADWRARLLAAVSPRPPAPPAPNRIDWPDY
SGRPAVWWGDGTVAGTHCVVAVWEFAVYGGSFGEIDAATFAAAAEHATATGLPLLSFLRS
GGTRLQEGVAGLVGLPQAALAAMRLAEAGVPHLAVVDQPTTGGVWVTVASRADLRCAVAG
ATVGFAGPRVVTAVTGTAPDASSHTAESAFAAGHVDVVAQPDQVEAWLATALAAVTAKPS
GSGAAGPAEVGPDDGIAMRRGWEQVQAARAPGRTAAGAALDALAPRGVELAGGDPTVRAR
LGLLADATGTGVVAVALAAVPRAAPGPAGFRLLERAARLAGRLGLPLVTFVDTPGADPSP
AAEAGGVAAAIGAAMGAVLACPSPTVCVVVGEGGSGGALAAACVDVLLMAPDSYLTALAP
EGAATTLRIPAERAADLGGLRPTDLRRLGFADGVLGSGEPAALAAAIAATLGRLHGSDQG
VRLSARGRKWSTGLPGRL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgccatccgacgtcggccgacctccacgccgagcggggggagcaagcacgc
cccgacccggcccaggaccgccctcgcgccccggccgactggcgcgcccgcctgctcgcc
gccgtcagtccgcggccaccggcgccgccggcgcccaaccggatcgactggccggactac
agcggacggcccgcggtctggtggggcgacgggacggtcgcgggaacccactgcgtcgtc
gcggtgtgggagttcgccgtgtacggcgggagcttcggcgagatcgacgcggccaccttc
gccgcggcggccgagcacgcgaccgcgacgggcctgccactgttgtccttcctgcgcagc
ggcggcactcggctgcaggagggcgtcgccggcctggtcgggctgccacaggcggcgctc
gcggcgatgcgcctggccgaggccggcgtgccacacctggccgtggtcgaccagccgacg
accggcggcgtgtgggtgacggtcgcgtcccgcgccgacctgcgctgcgcggtcgcggga
gcgacggtcgggttcgccggcccccgggtcgtcacggcggtcaccggcacggcccccgac
gcttccagccacaccgccgagtcggcgttcgcggccgggcacgtcgacgtcgtcgcccag
ccggaccaggtcgaggcctggttggcgacggcgctcgccgccgtgacggcgaagccctcc
ggttcgggtgccgccggcccggcagaggtcggtcccgacgacgggatcgccatgcggcgc
ggctgggagcaggtccaggcggctcgcgcgcccgggcggaccgccgccggcgccgcgctc
gacgcgctggcgccgcgcggcgtcgagctcgcgggcggggacccgacggtgcgggcccgg
ctgggcctgctcgccgatgccacgggtaccggggtggtcgccgtggcgctggcagcggtg
ccgcgcgcggcccccgggccggccggcttccgcctgctggagcgagccgctcgcctggcc
ggccggctcgggctcccgctggtgaccttcgtcgacacccccggtgccgacccgagcccg
gcggccgaggccggcggcgtcgccgcggcgatcggtgcggcgatgggggcggtgctggcc
tgcccgagcccgaccgtctgcgtcgtcgtcggcgagggcggttcgggcggagcgctggcc
gcggcctgcgtggacgtcctgctgatggccccggacagctacctgacggcgctcgccccg
gagggggcggccacgacgttgcgcatcccggccgagcgggcggccgacctcggtggcctg
cggcccaccgacctgcgccggctcggcttcgccgacggcgtgctcggctccggtgagccg
gcggcgctcgccgcggccatcgccgcgacgctcggccgtctccatggctctgaccagggc
gttcgcctctccgccaggggccggaaatggtcgacggggctacctggacgtctgtaa

DBGET integrated database retrieval system