KEGG   Frankia sp. EuI1c: FraEuI1c_1230Help
Entry
FraEuI1c_1230     CDS       T01354                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00564  Glycerophospholipid metabolism
fri01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FraEuI1c_1230
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FraEuI1c_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA 3HCDH_N NAD_binding_8 Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: ADP79302
UniProt: E3J2D0
LinkDB All DBs
Position
complement(1553510..1555570)
Genome map
AA seq 686 aa AA seqDB search
MPGTDPSDGFVPDAAAVPPIATAGGRLGPAQRAEALRRLATETFDVLVIGGGVTGAGTAL
DAAARGLSVALVEARDLAAGTSSRSSKLIHGGLRYLEQLNGALVREALRERTLLLETLAP
HLVRPVPFLLPLTHHGWERAYIGSGVLLYDTLGQGLARISPAPGTQHSGGLPLHRHLTRK
AALREFPALRPDALVGAIQYWDGQVDDARHTMFVARTAARYGAAVVTSAPVVGLLREEDR
VTGAVVRDLESPGGAEIRVRARQTIGATGVWTDDLHALLGGARGPVSVRASKGVHLVVPR
DRLQGTTGLILRTERSVLFVIPWGTHWIIGTTDTDWELDLAHPAATRADIDYLLDQLNRV
LRSPLTRDDIVGVYAGLRPLLAGESEDTAQLSREHAVLAAAPGLTTVAGGKYTTYRVMAE
DAVDAAAAGLTRVVPPSCTDKTPLLGADGYQALWNARERLAERAGLHVARIEHLLRRYGT
LTEELVDLVVADPSLGAALPGAEAYLAVEALYAVTHEGALRLEDVLTRRTRISFEAADRG
LAAAGPVAALVAPVLGWDETRTRAEIDLYEARVAAERASQETPDDATADVARRAAPDARR
LPSVRATARPQPTPPVPAEVDLDETVPITGVTVASAATSAAATAAASLRAARRAVVSSIS
RVSSNGGTGPSHPDGAAPGTMTDLAS
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcacggacccttcggacggcttcgtccccgacgccgccgccgtcccgccgatc
gccacggccggcggccgcctcgggccggcgcagcgcgccgaggcactgcggcgcctcgcc
accgagacgttcgacgtgctcgtcatcggcggcggcgtcaccggcgccggcaccgcgctg
gacgcggcggcccgcggcctgtccgtcgccctcgtcgaggcccgcgacctcgcggcgggc
acgtccagccggtccagcaagctgatacacggcgggctgcgttacctggagcagctcaac
ggcgcgctggtccgcgaggcgctgcgggagcggaccctgctgctcgagacgctggccccg
cacctggtccgcccggtgccgttcctgctgccgttgacgcaccacggctgggagcgggcc
tacatcggcagcggcgtgctgctctacgacaccctgggccagggcctggcccggatcagc
ccagctcccggcacacagcactccggcggtctgccgctgcaccggcatctgacccgcaag
gcggcgctgcgcgagttcccggcgctgcggcccgacgccctcgtcggcgcgatccagtac
tgggacgggcaggtcgacgacgcccggcacacgatgttcgtcgcccgcaccgcggccagg
tacggcgccgcggtcgtgacgtccgctccggtcgtcgggctgctgcgggaggaggaccgg
gtgaccggcgcggtcgtgcgcgacctggagtcgcccggcggggccgagatccgggtccgg
gcccgccagacgatcggcgccaccggggtgtggaccgacgacctgcacgcgctgctcggc
ggcgcccgggggcccgtctccgtgcgggcgtcgaagggcgtccatctggtcgtcccgcgc
gaccggctgcagggcaccaccgggctgatcctgcgcaccgagcgcagcgtgctgttcgtc
atcccctggggcacccactggatcatcggtaccaccgacaccgactgggagctcgacctc
gcccacccggcggcgacccgggccgacatcgactatctgctcgaccagctcaaccgggtg
ctgcgcagcccgctcacccgggacgacatcgtcggggtctacgccggcctgcgcccgctg
ctggccggcgagtccgaggacacggcgcagctgtcccgcgagcacgccgtcctcgccgcc
gcgccgggactcaccacggtcgccggcgggaagtacacgacctaccgggtgatggccgag
gacgcggtggacgcggcggccgccgggctgaccagggtggtaccgccgtcgtgcaccgac
aagaccccgctgctcggagccgacgggtaccaggcgctgtggaacgcccgcgagcggctc
gccgagcgcgccggcctgcacgtcgcccggatcgagcacctgctacgccggtacgggacg
ctgaccgaggaactcgtcgacctggtcgtcgcggacccgagcctgggcgcggcgctgccc
ggcgcggaggcgtatctcgccgtcgaggcgctgtacgcggtgacgcatgagggcgcgctg
cggctggaggacgtgctgacccgccgcacccgcatctccttcgaggccgcggaccggggc
ctggccgccgccgggccggtcgcggcgctggtcgccccggtgctcgggtgggacgagacg
cggacccgcgccgagatcgacctgtacgaggcccgcgtcgccgccgagcgcgcgtcccag
gagacgcccgacgacgccacggccgacgtcgcccgccgcgcggcgccggacgcccgccgg
ctgccgtccgtgcgcgccaccgcccgcccgcagccgacgccccccgttcccgcggaggtg
gacctggacgagacggtcccgatcaccggggtcaccgtcgcgtcggccgcgacctcggcg
gcggccaccgccgcggcgagcctgcgcgccgcccgccgcgccgtcgtcagctcgatcagc
cgggtgtccagcaacggcggcaccggcccgtcccaccccgacggcgccgcaccgggcacc
atgaccgacctggcctcctga

DBGET integrated database retrieval system