KEGG   Frankia sp. EuI1c: FraEuI1c_1399Help
Entry
FraEuI1c_1399     CDS       T01354                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh HTH_31
Motif
Other DBs
NCBI-ProteinID: ADP79466
UniProt: E3J515
LinkDB All DBs
Position
1746680..1748128
Genome map
AA seq 482 aa AA seqDB search
MKEHGTLFIGGRWVAPRAERTIEVISPHTEQPIARVAAAGPPDVDDAVSAARHAFDEGPW
PRLDPAERIEAVRRLADLYGTRRDELAELITDQLGAPISFARRAQVALPWSMMNALTDLA
RTYPWQENRPGVYGQDILLRKEPVGVVAAVIPWNMPQFLTVTKVVPALLAGCTVVLKPAP
ESPLDALFLAGLVEEAGLPPGVVNVIPADRDTSAHLVAHRGLDKVSFTGSTAAGRQVAGA
CAQNLTKVSLELGGKSAAIALDDADPSAVASAVRLSGLGMAGQICNALTRVVVPANRADD
YAQALAATMSALNVGDPTDPATEMGPLVARRQQERVRHYIDTGVREGATLVTGGSDLPAG
VERGWYVRPTVLGAVHPSMTVAREEIFGPVIVVIPYRDDEEAIRIANDSAYGLAGSVFTT
DKARGLDVASKVRTGTFGINQGYSMDPAAPFGGVKASGYGRELGREGLEAYLDVKSISVG
PI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcacggcacgctgttcatcggaggccggtgggtcgccccccgcgccgagcgg
accatcgaggtgatctctccgcacaccgagcagccgatcgcccgcgtcgcggccgccggg
ccgccggacgtcgacgacgccgtctcggccgcgcgccacgccttcgacgaggggccctgg
ccgcgtctcgacccggccgagcggatcgaggcggtccgccgcctggccgacctctacggc
acccgccgcgacgagctggccgagctgatcaccgaccagctcggcgcgccgatctccttc
gcccggcgagcccaggtcgcgctgccgtggtcgatgatgaacgcgctgaccgacctcgcg
cgcacctatccctggcaggagaaccggcccggtgtctacggccaggacatcctgctgcgc
aaagagcccgtcggggtcgtcgccgcggtgatcccgtggaacatgccgcagttcctgacc
gtcaccaaagtcgttccggcattgctcgcgggctgcacggtcgtcctgaagccggcgccc
gaatcgccgttggacgcccttttcctcgcgggcctcgtcgaggaggccgggcttccgccc
ggcgtcgtgaacgtgatcccggcggaccgggacaccagcgcccacctcgtcgcccatcgg
ggcctcgacaaggtctccttcaccggctctaccgccgccggccggcaggtcgcgggagcc
tgcgcgcagaacctcaccaaggtcagtctggagctgggcgggaaatcggcggccatcgcg
ctcgacgacgccgacccgtcggccgtggcgagcgccgtgcgcctttccgggctgggaatg
gccggccagatctgcaacgccctcacccgcgtcgtcgtcccggccaatcgcgccgacgac
tacgcgcaggccctcgccgcgacgatgtcggcgctcaacgtcggcgaccccaccgatccg
gcgaccgagatgggcccgctggtggcccggcgccaacaggaacgcgtgcggcattacatc
gacaccggcgtgcgcgaaggggccacgctcgtcaccgggggcagcgacctgcccgccggt
gtcgaacgaggctggtatgtccgcccgaccgtgctcggcgcggtgcatccgtcgatgacc
gtcgcccgtgaggagatcttcgggccggtcatcgtcgtgattccctaccgcgacgacgag
gaggccattcgcatcgcgaacgacagcgcctacgggctggcgggctccgtgttcaccacc
gacaaggcgcgcgggcttgacgtcgccagcaaggtccgtaccgggacgttcggtatcaac
cagggatactcgatggaccccgcggcgcccttcggcggcgtcaaggccagtggctacggc
cgagagctcggccgcgagggcctggaggcctacctggacgtcaagtccatctccgtcggc
ccgatctga

DBGET integrated database retrieval system