KEGG   Frankia sp. EuI1c: FraEuI1c_1878Help
Entry
FraEuI1c_1878     CDS       T01354                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00620  Pyruvate metabolism
fri00680  Methane metabolism
fri01100  Metabolic pathways
fri01120  Microbial metabolism in diverse environments
fri01200  Carbon metabolism
Module
fri_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FraEuI1c_1878
  09102 Energy metabolism
   00680 Methane metabolism
    FraEuI1c_1878
Enzymes [BR:fri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FraEuI1c_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ADP79930
UniProt: E3JCU0
LinkDB All DBs
Position
complement(2292726..2295632)
Genome map
AA seq 968 aa AA seqDB search
MTAMDHRGEARTSGAGSDPGPGTEQGLNSEHGPNSEQSLDAGTFAGGVASDVRHAGVRAG
VRRLGQLLGESLTRHEGAQLLELVERVRALARDSGDRADLHRVLADVDHPTAIVLARAFT
AYFQLANITEQLHRARELADRPRGAIEETGGRIAAAVAAGQLDPELPAQVVSRLELRPVF
TAHPTEASRRSVLDVLRGIAELLDAADDPRAQPSRRAVVDRRLAEAVDVLWQTDELRVER
PKPTDEARSAAYYLTSIATDVLPGLLEELDGALAQVGAGLPITARPLRFGTWAGGDRDGN
PNVTPTVTLDVLTLQHEFGIRVLLGAVDGLIKDLTASTRVVEVSDELVASLDADRAAHPE
VYDRFIRLNAAEPYRLKASYLRARLAATRDRLAAGTAHVPGRDYLSLRGLLADLTVMHRS
LMDNRGQLVADGPLRRTIRVAAAVGMSLATLDIREHGERHHAALGALYDRLDELPRPYAD
LDRHERIALLSRELAGRRPLSGAAAPAPADPTAAAVLELFATIRVALDRFGEDVIESYIV
SMTRDVDDILAVVVLAREAGLLEITPGAGARARIGFVPLFETVAELRAAGRLLDGMLADP
SYRAVVAARGDLQEIMLGYSDSSKDAGITASQWEIHRAQRELRDVARRHGVVLRLFHGRG
GSVGRGGGPTGEAILAQPFGTLDGPIKVTEQGEVISDKYTLPQLARHNLEIALAAVLEAS
ILHRESRQPLDVLAEWDQTMEAVADSARTAYRALTTDPALVPFFLAATPVDELGHLNIGS
RPSRRPGGVGGLEDLRAIPWVFGWTQSRIILPGWFGLGTGLAAARAAGAGDTLAEMYRSW
HFFRTFLSNVSMTLAKTDLRIASDYVTTLVPAEKAGPFEVIRAEHERTVAEVLAVTGSAT
LLEHAPVLRQTLEVRDLYLAPLHALQVSLLARSRAAAQTDPGGEIDPRLRRALLLTINGI
AAGLRNTG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgatggaccaccgcggcgaggcacggacgagcggcgccgggagcgatcccggg
ccgggcaccgagcagggcctgaactccgagcacggcccgaactccgagcagagcctggac
gccgggacgttcgccggcggggtcgcctcggatgtgcggcacgccggggtgcgggccggg
gtgcgccggctcggccagctgctcggcgagtcgctgacccggcacgagggcgcccagttg
ctggagctcgtcgagcgggtgcgcgcgctggcccgcgacagcggcgaccgcgccgacctg
caccgggtgctcgcggacgtcgaccacccgaccgcgatcgtgctggcccgggcgttcacc
gcgtacttccagctcgccaacatcaccgagcagctgcaccgggcccgcgagctggccgac
cgcccgcggggcgcgatcgaggagacgggcggccggatcgcggcagcggtggccgccggc
cagctcgacccggagctgcccgcccaggtggtgagccgcctggagcttcgcccggtgttc
accgcgcacccgacggaggcgagccgccggtcggtgctcgatgtgctgcgcgggatcgcc
gagctgctcgacgcggccgacgacccgcgggcgcagccgtcgcggcgggccgtggtcgac
cgccggctcgccgaggccgtcgacgtgctgtggcagaccgacgagctgcgggtcgagcgc
ccgaagcccaccgacgaggcccgctcggccgcctactacctgacctcgatcgccaccgac
gtgctgcccggcctgctggaggaactcgacggcgcgctcgcgcaggtcggggccgggctg
ccgatcaccgcccggccgctgcggttcggcacgtgggccggcggcgaccgggacggcaac
ccgaacgtcacccccaccgtgaccctcgacgtgctcacgctgcagcacgagttcggcatc
cgggtgctgctcggcgctgtcgacggcctgatcaaggatctgacggcctccacgcgggtc
gtcgaggtcagcgacgagctggtggcgagcctcgacgccgaccgggcggcccatcccgag
gtgtacgaccggttcatccgcctcaacgccgccgagccgtaccggctgaaggccagctac
ctgcgcgctcggctggccgccacccgcgaccggctggccgccggcaccgcgcacgtgccc
ggccgcgactacctgagcctgcgcggcctgctcgccgacctgaccgtcatgcaccggtcg
ctgatggacaaccggggccagctggtggccgacgggccgctgcgacgcacgatcagggtc
gccgcggcggtcgggatgtcgctcgcgacgctcgacatccgcgagcacggcgagcgccat
cacgcggcgctcggcgcgctctacgaccggctcgacgagctgccccgcccgtacgcggac
ctcgaccggcacgagcggatcgcgctgctgtcccgggagctggcgggacgccggccgctg
tccggagcggcggcgcccgccccggccgacccgaccgccgcggccgtgctggagctgttc
gccacgatccgggtcgcgctcgaccggttcggcgaggacgtcatcgagagctacatcgtg
tcgatgacccgggacgtggacgacatcctcgcggtcgtcgtgctcgccagggaggccggc
ctgctcgagatcacccccggcgccggtgcgcgggcgcgaatcgggttcgtgccgctgttc
gagaccgtcgccgagctgcgcgccgccgggcggctgctcgacggcatgctcgccgacccg
tcctaccgggcggtcgtcgccgcccgcggcgacctccaggagatcatgctcggctactcg
gactcctcgaaggacgccggcatcaccgcgtcccagtgggagatccaccgagcccagcgc
gagctgcgtgacgtggcccgccggcacggcgtcgtgctgcggctgttccacggccgcggc
ggctcggtcggccggggcggcggccccaccggcgaggcgatcctcgcccagccgttcggc
accctcgacggcccgatcaaggtcaccgagcagggcgaggtgatctcggacaagtacacg
ctcccccagctcgcccggcacaacctggagatcgcgctggccgccgtgctggaggcgtcg
atcctgcaccgggagtcccgccagccgctggacgtgctggccgagtgggaccagacgatg
gaggcggtcgccgactcggcccgcaccgcctaccgggcgctgacgaccgacccggcgctg
gtgccgttcttcctcgcggcgacgcccgtcgacgagctgggccacctcaacatcggctcc
cggccgtcgcggcggccgggcggggtcggcgggctggaggacctgcgcgcgatcccgtgg
gtgttcggctggacccagtcgaggatcatcctgcccggctggttcggcctcgggaccggg
ctcgcggcggccagggcggccggagcgggcgacacgctggccgagatgtaccggtcgtgg
cacttcttccgcacgttcctgagcaacgtgtcgatgacgctggcgaagaccgacctgcgg
atcgcctcggactacgtcacgacgctggttcccgccgagaaggccggcccgttcgaggtg
atccgcgccgagcacgagcggaccgtcgccgaggtgctggccgtcaccgggtccgcgacg
ctgctcgagcacgcaccggtgctgcgccagacgctggaggtgcgcgacctctacctcgcg
ccgctgcacgcgctgcaggtctcactgctcgcccgctcccgcgccgccgcccagaccgac
cccgggggcgagatcgacccccgcctgcgccgggccctgctgctgaccatcaacggcatc
gccgccggcctgcgcaacaccgggtga

DBGET integrated database retrieval system