KEGG   Frankia sp. EuI1c: FraEuI1c_2300Help
Entry
FraEuI1c_2300     CDS       T01354                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADP80339
UniProt: E3IZ56
LinkDB All DBs
Position
complement(2821966..2823048)
Genome map
AA seq 360 aa AA seqDB search
MQLPVMPPVAPMLAKSVPTIPSGASYEPKWDGFRCICFRDGDEVELGSRNEKPMTRYFPE
LVEAIKAELPDRCVLDGEIVIALDGRLDFEALQQRIHPAVSRVKLLSGTTPASFIAFDLL
ALGDEDYTGRPFAERRAALEAALAPAKAPIHLTTTTTDLDVANRWFVELEGAHLDGVIAK
PLDGVYQPDKRVMFKIKHVRTADCVLAGFRWHKTSTEAAPLVGSLLLGLYNDEHKLQHVG
VVGAFTAKRRAELVDELAPLLLGDGDDHPWQEWASAEAHQGQRLPGNVNRWNAQKDLSFI
PLRPERVLEVKYEHMEGTRFRHLAHFVRWRADRTPASCTYEQLEQPLTYTLSDIVPGLGS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcccgtgatgccgccggtcgcgccgatgctggcgaagtcggttccgaccatc
ccgtccggggcgtcctatgagcccaaatgggacggcttccgatgcatctgtttccgggac
ggtgacgaggtcgagctcggcagccgcaacgagaagccgatgacccgctacttccccgag
ctggtcgaggcgatcaaagccgaactacccgaccggtgcgtcctcgacggcgagatcgtc
atcgctctggacggcaggctggacttcgaggcgttgcagcagcgcatccaccccgcggtg
tcgcgggtgaagctgttgagcgggacgaccccggcctcgttcatcgcattcgatctgctc
gcgctcggcgacgaggactacaccgggcgcccgttcgccgagcggcgcgccgcgctcgag
gccgcgttggccccggcgaaggcgccgatccacctcaccacgaccaccaccgacctcgac
gtcgccaaccgctggttcgtcgagctcgaaggcgcgcacctcgacggcgtgatcgccaaa
ccgctcgacggcgtctaccagcccgacaagcgcgtcatgttcaagatcaagcacgtccgc
accgccgactgcgtcctcgccggcttccgctggcacaagacctccacggaggctgccccg
ctcgtcggctcgctgctgctcgggctctacaacgacgagcacaagctgcagcacgtcggc
gtcgtcggtgccttcacggccaagcgccgggccgagctggtcgacgaactcgcgccgctc
ctgctcggcgacggcgacgaccatccgtggcaggagtgggccagcgccgaggcgcaccag
ggccagcggctgcccggcaacgtgaaccggtggaacgcgcagaaggacctgtcgttcatc
ccgctgcgtcccgagcgggtgctggaggtcaagtacgagcacatggagggcacccgcttc
cggcacctggcgcacttcgtccgctggcgcgccgaccgcacccccgcttcctgcacctac
gagcagcttgagcagccgctcacctacaccctctccgacatcgttcccggactcggctcg
tag

DBGET integrated database retrieval system