KEGG   Frankia sp. EuI1c: FraEuI1c_2858Help
Entry
FraEuI1c_2858     CDS       T01354                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dhC
Motif
Other DBs
NCBI-ProteinID: ADP80884
UniProt: E3J905
LinkDB All DBs
Position
3456913..3458400
Genome map
AA seq 495 aa AA seqDB search
MTQPRDTVLALRHPDKFFIGGAWVEPSSEARFGVVDSHTEEVFLTVAEAQEADVRRAVDA
AYEAFHHGPWPRLSHAERAEYLRAVAKGIRDRAEDFGLALPRESGMIHAIARGAPHMEAG
FYELFAGMADTFPFEEPAKASYGGFGLIVREPVGVVGAIVPWNGPLSTIVQKTAPALLAG
CTVIVKSAPESPVEGLLLAEIMESVGLPPGVINFVTADRQASEALVRDPRVDKITFTGST
AAGRRIASICGERIARCTLELGGKSAAVVLDDFDIAEAAATLTFFECINTGQVCSSLTRI
VVTGDRHDAMVEALADLFSRVKVGDPFEADTGMGPLVSRRQRDRVEGYIAKGISDGAKLA
AGGGRPRDLDRGWYVEPTVFGDVDNGSTIAQEEIFGPVLSVIRAENEEDAVRIANESNFG
LNASVFTNDLERAQAVAGQLRSGTVGHNTMATDFGIAFGGFKQSGIGREGGTEGLLPFLE
TKTVILKNTPDRYRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagccccgagacaccgtgttggcactgcggcacccggacaagttcttcatcggc
ggggcgtgggtcgagccttccagtgaggcgcgcttcggggtcgtcgactcgcataccgag
gaagtcttcctcacggtcgccgaggcgcaggaggcggacgtcaggcgtgcggtcgacgcc
gcgtacgaggcgttccaccacggtccgtggcccaggctctcgcacgccgagcgggccgag
tacctgcgagcggtcgccaaggggatcagggaccgggccgaggacttcggcctcgctctt
ccccgcgagagcggaatgattcacgcgatcgcgcggggtgctccgcacatggaggcgggc
ttctacgagctcttcgccggaatggcggacaccttcccgttcgaggagccggcgaaggcc
agctacggcggcttcggcctgatcgtgcgggagcccgtcggcgtcgtgggcgcgatcgtc
ccctggaacgggccgctgtcgaccatcgtccagaagaccgcgccggcgctgttggccggc
tgcacggtgatcgtgaagtccgcgcccgagtctccggtcgaggggctcctgctcgccgag
atcatggagtcggtcgggctgccgccaggcgtcatcaacttcgtgaccgcggaccggcag
gcgtccgaggctctggtcagagacccccgggtcgacaagatcacgttcacgggctccacg
gctgccggtcggcgtatcgcctcgatctgtggcgagcggatcgcccgctgcacgctggag
ctcggcggcaagtcggcggccgtcgtcctcgacgacttcgacatcgccgaggcggccgcg
acgctgaccttcttcgagtgcatcaacacggggcaggtctgctcgtcgctcacgaggatc
gtggtcaccggggaccggcacgacgcgatggtcgaggcgctcgcggacctgttctcgcgg
gtgaaggtcggagatccgttcgaggcggacaccgggatgggcccgctcgtgtcgcggcgg
cagcgcgaccgggtcgagggctacatcgccaagggcatctcggacggcgcgaagctcgcc
gcgggtggtggccgcccgcgggacctcgaccgtggctggtacgtcgagccgacggttttc
ggggacgtcgacaacggttcgacgatcgcccaggaggagattttcgggcctgtcctcagc
gtcatccgagccgaaaacgaggaagacgcggtacggatcgcgaacgagtcgaatttcggc
ctgaacgcttcggtcttcaccaacgacctagagcgggctcaggccgtagccggacagctg
aggtcgggcacggtcgggcacaacacgatggcgaccgacttcggcatcgcgttcggtggc
ttcaagcagtccggcatcggacgggaaggcggcaccgaaggccttctcccgttcctcgag
acgaagacggtcattctgaaaaataccccggacaggtaccgtctgtag

DBGET integrated database retrieval system