KEGG   Frankia sp. EuI1c: FraEuI1c_3593Help
Entry
FraEuI1c_3593     CDS       T01354                                 

Definition
(GenBank) NUDIX hydrolase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: ADP81600
UniProt: E3J0H1
LinkDB All DBs
Position
4410905..4411381
Genome map
AA seq 158 aa AA seqDB search
MRGVRRVDYYHVPAAPAPNSLVVGGCAVVPDQDGRILLQRRADNGEWALPGGGMDLGETF
AGCIIREVREETGFDVVVDRIVGIYSDPEHVFAYENGEVRQQFSICCACTLVGGSLAVSD
ESTAVAFFTLDEIAGLGMHPSHRIRIRDYLADEAPFLR
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtgtgcgccgcgtcgactactaccacgtgcccgcggctcccgcgccgaactcg
ctggtggtcggtggctgcgcggtcgtaccggaccaggacggccggatcctgctgcaacgg
cgggccgacaacggcgaatgggcgctgcccggcggcgggatggacctcggcgagacgttc
gccggctgcatcatccgggaggtccgcgaggagaccgggttcgacgtcgtcgtcgaccgg
atcgtcgggatctactcggacccggagcacgtcttcgcgtacgagaacggcgaggtccgc
cagcagttctcgatctgctgcgcctgcaccctcgtcggcggctcgctggcggtcagcgac
gagtcgaccgcggtggccttcttcaccctcgacgagatcgcgggcctcggcatgcacccg
tcgcaccgcatccgcatccgcgactacctggcggacgaggcaccgtttctccgatag

DBGET integrated database retrieval system