KEGG   Frankia sp. EuI1c: FraEuI1c_4641Help
Entry
FraEuI1c_4641     CDS       T01354                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00250  Alanine, aspartate and glutamate metabolism
fri00280  Valine, leucine and isoleucine degradation
fri00310  Lysine degradation
fri00410  beta-Alanine metabolism
fri00640  Propanoate metabolism
fri00650  Butanoate metabolism
fri01100  Metabolic pathways
fri01120  Microbial metabolism in diverse environments
Module
fri_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FraEuI1c_4641
   00650 Butanoate metabolism
    FraEuI1c_4641
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FraEuI1c_4641
   00280 Valine, leucine and isoleucine degradation
    FraEuI1c_4641
   00310 Lysine degradation
    FraEuI1c_4641
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FraEuI1c_4641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fri01007]
    FraEuI1c_4641
Enzymes [BR:fri01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     FraEuI1c_4641
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     FraEuI1c_4641
    2.6.1.48  5-aminovalerate transaminase
     FraEuI1c_4641
Amino acid related enzymes [BR:fri01007]
 Aminotransferase (transaminase)
  Class III
   FraEuI1c_4641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADP82634
UniProt: E3IY36
LinkDB All DBs
Position
complement(5689543..5690955)
Genome map
AA seq 470 aa AA seqDB search
MTTTAGPSTPVSAVLAATGETPGPRAVTGGPGLPQRRQLVTELPGPRSRELLARREAAVA
RGVSITFPVFVVAAGGGILVDVDGNALIDLGSGIAVTTVGNSAPAVVDNVIRQVQAFTHT
CFMITPYEGYVAVCEQLARLTPGDHEKRSALFNSGAEAVENAVKIARIHTGRQAVVVFDH
AYHGRTNLTMALTAKNHPYKNGFGPFAPEIYRVPLSYPYRDGLSGAEAAARAIRVIESQI
GAHNVAAVLIEPIQGEGGFVVPAEGFLPALAAWSKAAGAVFVADEVQTGFARTGAMFGCE
HEGVVPDLIATAKGIAGGLPLSAVTGRAEIMDSAHPGGLGGTYGGNPLACAAALGAIETI
ERDGLVERARAIGARVLPRLRAVAARVPALGDVRGRGAMLAVEIVDPATGRPDGAAAGAV
ARRCHAEGVVVLTCGTDGNVLRLLPPLAIGDELLDDGLAVLVTALESLAG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaccgccggcccgtcgacgccggtctccgcagtgttggccgcgacgggggag
acccccggcccgcgcgcggtgaccggcgggccgggcctgccacagcggcgtcagctggtc
accgagctcccggggccccggtcccgggagctgctggcccgccgggaggccgcggtcgcc
cggggcgtctcgatcaccttcccggtgttcgtcgtggcggccggcggcggcatcctggtc
gacgtcgacggcaacgcgctgatcgacctcggctccggtatcgccgtgacgaccgtcggc
aacagcgccccggccgtcgtcgacaacgtgattcgccaggtccaggcgttcacccacacc
tgcttcatgatcacgccctatgagggctacgtcgcggtctgtgagcagctggcccggctc
acgcccggcgaccacgagaagcgctccgcgctgttcaactccggcgccgaggccgtcgag
aacgccgtcaagatcgcccgcatccacaccgggcggcaggccgtcgtcgtgttcgaccac
gcctaccacggccgcaccaacctgacgatggccctgacggcgaagaaccacccctacaag
aacgggttcggcccgttcgccccggagatctaccgcgtcccgctgtcgtacccgtaccgc
gacgggctgtccggggccgaggcggcggccagggcgatccgcgtcatcgagagccagatc
ggcgcccacaacgtcgcggcggtcctcatcgagccgatccagggcgagggcggcttcgtc
gtcccggccgagggtttcctgcccgcgctggcggcctggtcgaaggcggccggcgcggtc
ttcgtcgccgacgaggtgcagaccgggttcgcccgcaccggggcgatgttcggctgcgag
cacgagggcgtcgtccccgacctgatcgccaccgccaagggcatcgccggcgggctgccg
ctgtccgccgtgaccggccgggccgagatcatggactcggcgcaccccggcggcctcggc
gggacctacggcggcaacccgctggcctgcgccgccgccctcggcgccatcgagaccatc
gagcgcgacgggctcgtcgagcgggcccgtgccatcggcgcgcgggtgctgccgaggctg
cgggccgtcgccgcgcgggtcccggccctcggcgacgtgcgcggccggggcgccatgctc
gccgtcgagatcgtcgaccccgccaccggccggcccgacggcgccgcggccggcgcggtc
gcccgccgctgccacgccgagggcgtcgtcgtgctcacctgcggcaccgacggcaacgtc
ctgcgcctgctgccgccgctcgccatcggcgacgaactgctggacgacggcctcgccgtc
ctcgtcacagccctggagtccctcgccggttga

DBGET integrated database retrieval system