KEGG   Frankia sp. EuI1c: FraEuI1c_4833Help
Entry
FraEuI1c_4833     CDS       T01354                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00010  Glycolysis / Gluconeogenesis
fri00230  Purine metabolism
fri00620  Pyruvate metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01200  Carbon metabolism
fri01230  Biosynthesis of amino acids
Module
fri_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fri_M00002  Glycolysis, core module involving three-carbon compounds
fri_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
fri_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_4833
   00620 Pyruvate metabolism
    FraEuI1c_4833
  Nucleotide metabolism
   00230 Purine metabolism
    FraEuI1c_4833
Enzymes [BR:fri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     FraEuI1c_4833
Membrane trafficking [BR:fri04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    FraEuI1c_4833
Exosome [BR:fri04147]
 Exosomal proteins
  Proteins found in most exosomes
   FraEuI1c_4833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADP82823
UniProt: E3J0Q4
LinkDB All DBs
Position
complement(5930403..5931818)
Genome map
AA seq 471 aa AA seqDB search
MPRRAKIVCTLGPATNSPERVRALVDAGMDIARLNFSHGTHEQHATVYRKVRDASAESGR
AVGILADLQGPKIRLGTFASGGVTLVPGEQFTITVRDVAGDQHQVGTTYPGLPGDVKTGD
RILVDDGRLVLTIDGVTDTDVHTTVVIGGPVSNNKGMNIPSAALTVPALTDKDEEDLRYA
LELGVDMVALSFVRSAADAEKVRKIMDEAGIRVPVIAKIEKPQAVAELDGIVEAFDGLMV
ARGDLGVELPLEDVPLVQKRVVSAARERAKPVIVATQVLESMISAPRPTRAEASDCANAV
LDGADAIMLSAETSVGEYPIESVSTMARIIETAEHDLSRVHPLRTAPRTLGGAIAQAAVE
VGAAVGARYLVAHTLSGDTARRLARYRSYVPILGFTPIPDMRNQMALFWGVETFVVPFAN
STDEMVRQVDEALLQIGRCSPGELVVVVAGTPPGVAGMTNTMRVHRIGEAV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgccacgaagagccaagattgtctgtacgttgggtccggctaccaactcccccgagcgc
gtgcgtgcccttgtcgatgccggaatggacatcgcacgcctcaacttctcccatggaacg
catgagcaacacgcgacggtgtaccggaaggtccgcgacgccagcgcggagtccggccgc
gcggtcggcatcctcgccgacctgcaggggccgaagatccggctggggaccttcgcctca
ggtggggtgaccctcgtccccggtgagcagttcacgatcaccgtgcgcgacgtcgcgggc
gaccagcaccaggtcggtaccacctacccgggcctgcccggcgacgtgaagaccggcgac
cggatcctggtcgacgacggccggctggtgctgacgatcgacggggtcaccgacaccgac
gtccacaccaccgtcgtcatcggcggcccggtcagcaacaacaagggcatgaacatcccc
agcgccgccctgaccgtcccggccctcacggacaaggacgaggaggacctgcgctacgcc
ctggaactgggcgtcgacatggtcgccctgtcgttcgtccgctcggccgccgacgcggag
aaggtccgcaagatcatggacgaggccgggatccgtgtcccggtcatcgccaagatcgag
aagccgcaggcggtcgccgagctggacggcatcgtcgaggcgttcgacgggctcatggtg
gcccgcggcgacctgggcgtcgagctcccgctcgaggacgtgccgctggtccagaagcgg
gtggtcagcgccgcccgggagcgggccaagccggtcatcgtcgcgacccaggtgctcgag
tcgatgatcagcgccccccggccgaccagggccgaggccagcgactgcgccaacgccgtc
ctggacggcgccgacgcgatcatgctgtcggcggagaccagcgtcggcgagtacccgatc
gagtccgtctccacgatggcccggatcatcgagaccgccgagcacgacctgtcccgggtg
cacccgctgcggaccgctccgcgcacgctcggcggcgcgatcgcccaggccgcggtcgag
gtcggcgccgcggtcggcgcccgctacctggtcgcgcacacgctgtcgggagacaccgcc
cgccggctggcccgctaccggtcgtacgtgccgatcctcgggttcaccccgatcccggac
atgcgcaaccagatggcgctgttctggggggtcgagacgttcgtcgtcccgttcgcgaac
agcactgacgagatggtccgccaggtcgacgaggcgctgctccagatcggccggtgcagc
ccgggcgagctcgtggtcgtcgtcgccggcacgccgccgggcgtcgccggcatgaccaac
accatgcgggtgcaccggatcggcgaggccgtctga

DBGET integrated database retrieval system