KEGG   Frankia sp. EuI1c: FraEuI1c_5076Help
Entry
FraEuI1c_5076     CDS       T01354                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00250  Alanine, aspartate and glutamate metabolism
fri00410  beta-Alanine metabolism
fri00430  Taurine and hypotaurine metabolism
fri00650  Butanoate metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri02024  Quorum sensing
Module
fri_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FraEuI1c_5076
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FraEuI1c_5076
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FraEuI1c_5076
   00430 Taurine and hypotaurine metabolism
    FraEuI1c_5076
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FraEuI1c_5076
Enzymes [BR:fri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FraEuI1c_5076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADP83065
UniProt: E3J4E6
LinkDB All DBs
Position
6243939..6245351
Genome map
AA seq 470 aa AA seqDB search
MGDQANARLAVRPQFRWPAGQARPGEETGGELPRYRIPAGPTDPETAYQLVHDELMLDGN
ARLNLATFVTTWMDPHADRLMAECAAKNMIDKDEYPQTAELEARCVSMLADLWHAADAAD
AVGCSTTGSSEAGMLAGLAMTRRWRAARRAAGLPADRPNLVMGANVQVCWEKFARYWDVE
ARLVPLAPGRTHLTADEAVRHCDENTVGVVAILGSTFDGTYEPVAEIAAALDRLAAGGGP
DVPVHVDAASGGFVAPFCDPDLLWDFRLDRVVSINASGHKFGLVYPGVGWVLWRDREHLP
EELVFHVDYLGGTMPTFALNFSRPGAQVVAQYYSLLRHGREGYRQVIQGCRDVATRLSGE
IAEMGPFALVSDGAGGGIPAFAFTLRDADAAGFSVFDVSELLRTRGWQVPAYRFPPALQE
LAVLRVVVRNGFGPDLADLLVADLRRVVDRLTDAGRPGPPPAEATAAFHH
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgggagaccaggcgaacgcgcggctggcggtccgcccgcagttccgctggcccgcgggg
caggcgcgcccaggcgaggagaccggcggcgagctgccgcgctaccgcatcccggccggg
ccgacggacccggagacggcctaccagctggtgcacgacgagctgatgctcgacgggaac
gcccggttgaacctcgccacgttcgtgacgacctggatggacccgcacgccgaccggctg
atggccgagtgcgccgccaagaacatgatcgacaaggacgagtacccgcagaccgccgag
ctggaggcgcgctgcgtgagcatgctcgccgacctctggcacgccgcggacgcggccgac
gcggtcggctgctcgacgaccggctcgtccgaggcgggcatgctcgccggtctggcgatg
acccgccggtggcgggccgcgcgccgcgccgcgggcctgccggccgaccggccgaacctg
gtgatgggcgcgaacgtgcaggtctgctgggagaagttcgcccgctactgggacgtcgag
gcccggctggtgccgctcgcgcccgggcgcacccacctcaccgccgacgaggccgtccgg
cactgcgacgagaacaccgtcggcgtcgtcgcgatcctcggctcgacgttcgacgggacg
tacgagccggtcgccgagatcgcggcggcgctcgaccggctcgcggccggcggcggtccc
gacgtgccggtccacgtcgacgccgcgtccggtggttttgtcgctcccttctgcgaccca
gacctgctctgggacttccggctcgaccgggtggtctcgatcaacgcgtcgggccacaag
ttcggcctggtctacccgggcgtcggctgggtgctgtggcgcgaccgcgagcacctgccc
gaggagctcgtcttccacgtcgactatctcggcgggacgatgccgacgttcgcgctcaac
ttctcccgccccggcgcgcaggtcgtcgcccagtactactcgctgctgcgccacggccgc
gagggctaccggcaggtgatccagggctgccgggacgtcgcgacccgcctgtccggcgag
atcgccgagatggggcccttcgcgctggtctccgacggcgccggcggcggcattcccgcg
ttcgcgttcacgctgcgcgacgccgacgcggccgggttcagcgtcttcgacgtgtcggag
ctactgcggacccggggctggcaggttcccgcctaccggttcccgccggcactgcaggag
ctcgccgtgctgcgggtcgtcgtgcgcaacgggttcggcccggacctggccgatctgctg
gtcgccgaccttcgccgcgtcgtcgaccggctcaccgacgcgggccgccccggcccgccg
cccgccgaggccacggccgcgttccaccactga

DBGET integrated database retrieval system