KEGG   Frankia inefficax: FraEuI1c_5335Help
Entry
FraEuI1c_5335     CDS       T01354                                 

Definition
(GenBank) dehydrogenase E1 component
  KO
K11381  2-oxoisovalerate dehydrogenase E1 component [EC:1.2.4.4]
Organism
fri  Frankia inefficax
Pathway
fri00280  Valine, leucine and isoleucine degradation
fri00640  Propanoate metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FraEuI1c_5335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FraEuI1c_5335
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.4  3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)
     FraEuI1c_5335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-ProteinID: ADP83323
UniProt: E3J9F9
LinkDB All DBs
Position
complement(6552323..6554293)
Genome map
AA seq 656 aa AA seqDB search
MTSIDVEEAGLDPATLGELYRRMRLIRRFEERASVLYRDSQIPGFLHLSIGQEASAVGAC
WPLDDRDVITSTHRGHGHCIAKGLDVTEMFAELMGRETGTNRGRGGSMHIADPRKGIFGA
NGIVAAGLPIAAGAATAAQLRASGGVVVAFFGDGAVGQGMFHEAVNLASVWDLPVIFLCE
NNHYAEFSPAADQSRSSLADRAQGYGIRYAHVDGNDVVAVAQAMSRHVRDLRLGARPLLF
EAETYRWHGHYEGDPEAYRDVAEVDTWKARDPLVVLARRMAPTQVAAIDREIDEQIEKAV
AAASEAPEPEPETLHHFVSSPREAVAEPPAPTGEIFRTMDAVHEALDYELGHDPDVFVAG
IDVGAGGNVFGLTRKLAARYPGRVRDTPISESAVIGTAVGAAMAGMRPVVEVMYLDFIGV
CLDQIMNQAAKLRFMSGGAVSLPLVIRTQFGAGRSSGSQHSQSLEALLAHIPGLTVVMPS
TPAETYGLLRAAIRDPNPVIFIENRLLYGRKGPRPEPDALVPLGKAAIRRPGTDVTLVSY
SRMVNDCLTAAEQLAAEGISVEVIDLRTIAPLDYETVLGSLARTNRLVIAHEAVTPFGVG
AELAAAAVREGFWTLDAPVIRVGAEATPAPYAPSLERAWLPSVERIAAAVRESAGA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccatcgacgtggaagaggccggtctcgacccggcgacgctgggtgagctctac
cggcggatgcggctgatccgacgcttcgaggaacgcgcgtcggtgctctaccgcgacagc
cagattcctggcttcctgcacctgtcgatcggccaggaggcctcggccgtcggggcgtgc
tggcccctggacgaccgggacgtgatcacctccacccaccgcggccacgggcactgcatc
gccaagggcctcgacgtcaccgagatgttcgccgagctgatgggccgcgagaccggcacg
aaccgcggccgcggcggctcgatgcacatcgccgacccgcgcaagggaatcttcggcgcg
aacggcatcgtcgcggccgggctgccgatcgccgccggcgcggccaccgcggcccagctg
cgcgcgtcgggcggcgtggtcgtcgcgttcttcggggacggcgcggtcggtcagggcatg
ttccacgaggcggtcaacctcgcctcggtctgggacctgccggtgatcttcctgtgcgag
aacaaccactacgccgagttctcgccggcggccgaccagagccgctcatcgctcgcggac
cgggcccagggctatggcatccggtacgcgcacgtcgacggcaacgacgtcgtcgccgtg
gcgcaggccatgtcgcggcacgtgcgcgacctgcgcctcggcgcgcggccgctgctcttc
gaggccgagacctaccgctggcacggccactacgagggcgaccccgaggcctaccgggac
gtcgccgaggtcgacacctggaaggcccgcgacccgctggtggtcctcgcgcgccggatg
gcgccgacgcaggtcgcggcgatcgaccgggagatcgacgagcagatcgagaaggcggtc
gcggcggcctccgaggcacccgagccggagccggagacgctgcaccacttcgtctccagc
ccgcgggaggccgtggccgagccgccggcgccgactggcgagatcttccggacgatggac
gcggtgcacgaggcgctcgactacgagctcggccacgacccggacgtcttcgtcgcgggc
atcgacgtcggcgccggcggcaacgtcttcgggctcacccgcaagctcgccgcgcggtac
ccgggccgggtgcgggacacgccgatctcggagagcgcggtcatcgggacggcggtcggg
gcggcgatggccggcatgcgcccggtggtcgaggtcatgtacctcgacttcatcggcgtc
tgcctggaccagatcatgaaccaggccgcgaagctgcgcttcatgagcggcggggcggtc
agcctgccgctggtgatccggacccagttcggggccggccgctcgtccggcagccagcac
tcgcagagcctggaggccctgctcgcgcacattcccgggctcaccgtcgtcatgccgtcg
acgccggcggagacctacggcctgctgcgcgccgcgatccgcgaccccaacccggtgatc
ttcatcgagaaccgcctgctctacggccgcaaggggccgcggcccgagccggacgcgctg
gtgccgctcggcaaggccgccatccgccggccgggcacggacgtcacgctcgtgtcctac
tcccggatggtgaacgactgcctgacggccgccgagcagctggccgccgaggggatcagc
gtcgaggtcatcgacctgcggacgatcgcgccgctggactacgagacggtgctcggctcg
ctggccaggacgaaccggctcgtcatcgcgcacgaggcggtgacgccgttcggggtgggc
gcggagctggccgcggccgcggtgcgcgagggcttctggacactcgacgcccccgtgatc
cgggtcggggccgaggcgacgccggcgccctacgcgccgtcgctcgaacgcgcctggctg
ccgagcgtcgaacggatcgccgcggcggtgcgcgagtcagccggcgcctag

DBGET integrated database retrieval system