KEGG   Frankia sp. EuI1c: FraEuI1c_5368Help
Entry
FraEuI1c_5368     CDS       T01354                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADP83356
UniProt: E3J9J2
LinkDB All DBs
Position
6593011..6594462
Genome map
AA seq 483 aa AA seqDB search
MQVQDRLFIGGEWVAPSGTDTFDVVSPATEEVIARVAEPTTVDVDKAVAAARAAFDEGPW
PRLPVAERVAAVRRLAALYKPGRGELAKIISSEMGAPISFAKLGHVAIPMFMMNAFAGIA
ENLEWEERRPGFYGQDILVRKEPVGVVGAIVPWNMPMHLTIGKLIPALLAGCSVVLKPSP
ETPLDAYWLADLLTRAELPAGLVSILPAGREVGEYLVSHPGVDKISFTGSTAAGRKVAAA
CGANLKRVGLELGGKSAAVVLDDADPAAMAKGVQVAGLMNSGQACVAQTRVLVPRSRYAE
YVDALAAMVAGLPTGDPSDPSTEVGPLVAQRQQDRVRGYIEIGQKEGARLVTGGTDLPAG
VDRGWYVRPTLFADVEPSMRIAQEEIFGPVLSVLPYTDEAEAIRIADATEYGLSGSVWTA
DVERGLGVARRVRSGTFGVNEAYSMDPAAPFGGVKASGIGRELGKEGIEGFLDSKSISVA
AGR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtacaggatcgactgttcatcggtggcgagtgggtcgcgccgagcggcaccgac
accttcgacgtcgtctcgccagccaccgaggaggtcatcgcccgggtcgccgagccgacg
accgtggacgtggacaaggcggtggccgcggcccgcgccgcgttcgacgagggtccctgg
ccccggctgccggtcgccgagcgggtggccgcggtccgccgcctcgcggcgctctacaag
ccgggccgcggcgagctcgcgaagatcatcagctccgagatgggcgccccgatcagcttc
gccaagctcggccacgtcgccatcccgatgttcatgatgaacgccttcgcgggcatcgcc
gagaacctcgagtgggaggagcgccggcccggcttctacggccaggacatcctggtgcgc
aaggagcccgtcggcgtcgtcggcgcgatcgtcccgtggaacatgccgatgcacctgacg
atcggcaagctgatccccgcgctgctcgccggctgctcggtggtgctgaagccgtcgccg
gagacgccgctggacgcctactggctggcggacctgctcaccagggccgagctgccggcc
ggcctggtcagcatcctgccggccggccgcgaggtgggcgagtacctggtctcccacccc
ggcgtcgacaagatctcgttcaccgggtccacggccgccggccgcaaggtcgcggcggcc
tgcggcgcgaacctcaagcgggtgggcctggagctcggcggcaagtccgccgccgtggtg
ctcgacgacgccgacccggcggcgatggccaagggcgtccaggtcgccggcctgatgaac
agcggccaggcctgcgtcgcgcagacccgggtcctggttccgcggtcgcgctacgccgag
tacgtggacgcgctggccgcgatggtcgcgggcctgccgaccggcgacccgtccgacccg
agcaccgaggtcggcccgctggtcgcccagcgccagcaggaccgggtccggggctacatc
gagatcggccagaaggagggtgctcggctcgtcaccggcggcaccgacctgccggccggg
gtcgaccgcggctggtacgtccgcccgacgctgttcgccgacgtcgagccctccatgcgg
atcgcgcaggaggagatcttcggcccggtcctctcggtgctcccgtacaccgacgaggcc
gaggccatcaggatcgccgacgcgaccgagtacggcctgtccggctcggtgtggacggcg
gacgtcgagcgcggcctgggtgtcgcccggcgggtgcgcagcggcaccttcggcgtgaac
gaggcctacagcatggacccggcggcgccgttcggcggcgtgaaggcgtccggcatcggc
cgcgagctgggtaaggaaggtatcgagggcttcctcgactccaagtcgatctcggtcgcc
gccggtcgctag

DBGET integrated database retrieval system