KEGG   Frankia sp. EuI1c: FraEuI1c_6152Help
Entry
FraEuI1c_6152     CDS       T01354                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00020  Citrate cycle (TCA cycle)
fri00480  Glutathione metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01200  Carbon metabolism
fri01210  2-Oxocarboxylic acid metabolism
fri01230  Biosynthesis of amino acids
Module
fri_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fri_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FraEuI1c_6152
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FraEuI1c_6152
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     FraEuI1c_6152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ADP84136
UniProt: E3J231
LinkDB All DBs
Position
complement(7584782..7587007)
Genome map
AA seq 741 aa AA seqDB search
MTDSTIIYTFTDEAPALATYSFLPVIQAYAAAAGVPVDSRDISLAGRIIATFSEYLDESQ
RIGDALAELGELALRPEANIIKLPNISASIPQLKAAVAELQGKGYALPDYPDEPKTDEER
AVRARYDSVKGSAVNPVLREGNSDRRAPASVKNYARNHPHKMGAWSADSKTNVATMGQND
FASTEKSAVIGAGGALRIELAAADGTTTVLKGSVKVLAGEVVDASVLRVGPLREFLTAQI
ARAKAEDVLFSVHLKATMMKVSDPIIFGHVVRAFFPSTFAAYGETIAAAGLTPNDGLGAI
LAGLAALPEGDAIKASFEAEIAAGPALAMVDSDRGITNLHVPSDIIVDASMPAMIRTSGH
MWGPDGSEADTLAVLPDSSYAGVYQVVLDDCRAHGAYDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIAADGVVRVVDDAGTVVLEQPVAAGDIFRMCQTKDAPIRDWVKLAVTRARATGD
PAVFWLDENRAHDAQLIAKVKAYLPEYDTTGLTIEILSPVAATAYSLERIRKGQNTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEQFAQVTGNASAKILGETLDRATGTFLNENKSPARRVGGIDNRGSHFY
LALYWAQELAAQTADEQLASAFAELAKSLADQETTITGELLAVQGSPTDIGGYYQPDPVK
ASAVMRPSATFNEAIATLNAG
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtgactgattcgacgatcatctatacgttcaccgacgaggcgccggccctggccacgtac
tcgttcctgccggtgatccaggcgtacgccgcggccgcgggcgtacccgtcgacagccgc
gacatctcgctcgccggccgcatcatcgcgaccttctcggagtacctcgacgagtcgcag
cggatcggcgacgcgctcgccgagctcggcgagctggccctgcggcccgaggcgaacatc
atcaagctgccgaacatctcggcctcgatcccgcagctgaaggccgcggtcgccgagctg
cagggcaagggctacgcgctgccggactacccggacgagccgaagaccgacgaggagcgc
gcggtccgcgccaggtacgactcggtcaagggcagcgccgtgaacccggtgctgcgggag
ggcaactccgaccggcgcgcccccgcctcggtgaagaactacgcccgcaaccacccgcac
aagatgggtgcctggagcgccgactcgaagacgaacgtcgcgacgatgggccagaacgac
ttcgccagcaccgagaagtcggcggtcatcggcgcgggcggcgcgctgcgcatcgagctg
gccgcggccgacggcacgaccaccgtcctcaagggctcggtcaaggtcctcgccggtgag
gtcgtcgacgcgtccgtgctgcgggtcggcccgctgcgcgagttcctcaccgcccagatc
gcccgggccaaggccgaggacgtgctgttctcggtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtgcgcgcgttcttcccgtcgacattcgcc
gcctacggcgagacgatcgccgccgccggcctcaccccgaacgacggcttgggcgcgatc
ctcgcgggcctggccgcgctgcccgaaggtgacgcgatcaaggcatccttcgaggcggag
atcgccgccggcccggcgctggcgatggtcgactccgaccgcggcatcaccaacctgcac
gtgccgagcgacatcatcgtcgacgcctcgatgccggctatgatccgcacctcgggccac
atgtggggcccggacggcagcgaggccgacaccctcgccgtgctgccggacagcagctac
gcgggcgtctaccaggtcgtcctcgacgactgccgggcgcacggcgcctacgacccggcg
acgatgggctcggtgcccaacgtcggtctgatggcccagaaggccgaggagtacggctcc
cacgacaagaccttcgagatcgcggcggacggcgtcgtgcgggtcgtcgacgacgccggc
acggtggttctggagcagccggtcgcggcgggcgacatcttccggatgtgccagaccaag
gacgccccgatccgcgactgggtgaagctcgccgtcacccgcgcccgggcgaccggcgac
ccggcggtgttctggctcgacgagaaccgcgcccacgacgcccagctgatcgccaaggtg
aaggcctacctgcccgagtacgacacgacgggcctgaccatcgagatcctctcgccggtc
gcggcgacggcctactcgctggagcggatccgcaagggccagaacaccatctcggtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtgccgctgatggccggtggcggcctgttcgagaccggtgcc
ggtggctcggcgccgaagcacgtccagcagctggtcaaggagaactacctgcggtgggac
agcctcggcgagttcctggcgctggcggtcagcttcgagcagttcgcccaggtaaccggc
aacgccagcgccaagatcctgggtgagacgctcgaccgggcgaccggcacgttcctcaac
gagaacaagtcgccggcccggcgcgtcggcgggatcgacaaccgcggcagccacttctac
ctggccctctactgggcccaggagctcgccgcgcagaccgccgacgagcagctggcctcc
gcgttcgccgagctcgccaagtcgctcgccgaccaggagacgacgatcaccggtgagctc
ctggccgtgcagggctccccgaccgacatcggcggctactaccagcccgacccggtcaag
gcgagcgccgtcatgcgcccgtccgcgaccttcaacgaggcgatcgccacgctgaacgcg
ggctag

DBGET integrated database retrieval system