KEGG   Frankia sp. EuI1c: FraEuI1c_6190Help
Entry
FraEuI1c_6190     CDS       T01354                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00473  D-Alanine metabolism
fri01100  Metabolic pathways
fri01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FraEuI1c_6190
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    FraEuI1c_6190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fri01011]
    FraEuI1c_6190
Enzymes [BR:fri01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FraEuI1c_6190
Peptidoglycan biosynthesis and degradation proteins [BR:fri01011]
 Precursor biosynthesis
  Racemase
   FraEuI1c_6190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADP84174
UniProt: E3J377
LinkDB All DBs
Position
complement(7636995..7638161)
Genome map
AA seq 388 aa AA seqDB search
MTQPTTATSADPVTPPRVYAAIDLDAVRASTAELVARAGSAATMAVVKADGYGHGMLPCA
RAALDAGATWLGVAVIEEALALRAAGITVPVMSWLMSPGEPLDAAIGAQIDLSASAPWAL
AEIAAAARSTGRPARVHLKADTGLGRAGATDADWPGLCDAAAALRAEGVLDVVGVWSHFA
FADAPGHPTVQGQIGRFTDAVEIAEKAGLRPEVRHLANSAATLVSPEAHFDLVRPGISIY
GLSPGPDVGRSAELGLRPAMRLAARVALAKRVPPGTGVSYAHRYVTDSETTLALVPLGYA
DGVPRAATNLGEVLLAGRRRRIAGTVCMDQFVLDVGDDQVAEGDEAVLFGPGDAGEPTAD
DWAAALGTINYEIVTRIGPRVPRIYLNP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactcagccgaccactgcgaccagtgcggacccggtgacgccgccgcgcgtgtacgcc
gccatcgacctggacgcggtgcgggcgtcgaccgcggagctggtcgcccgcgccggttcc
gcggcgaccatggcggtcgtcaaggccgacggctacggccacggcatgctgccgtgcgcc
cgcgccgcgctcgacgccggcgcgacctggctcggggtcgccgtgatcgaggaggcgctg
gcgttgcgtgcggccggcatcacggtgccggtgatgtcctggctgatgtcgccgggagaa
cctctcgacgcggccatcggcgcccagatcgacctgtcggcctccgcgccctgggcactg
gcggagatcgccgctgccgcccggtccaccggccgcccggcccgggtccacctgaaggcg
gacaccgggctcggccgggccggcgccaccgacgccgactggccgggcctgtgcgacgcg
gccgccgccctgcgcgccgagggtgtgctcgacgtcgtcggggtgtggagccatttcgcg
ttcgccgacgcgcccggccatccgaccgtgcagggccagatcggccggttcaccgacgcg
gtcgagatcgcggagaaggctgggctgcgccccgaggtgcgccacctggcgaactcggcc
gccaccctggtcagcccggaggcccatttcgacctggtccggccggggatctcgatctac
gggctgtcgccgggccccgacgtcggccggtccgccgagctgggcctgcgcccggcgatg
cgcctcgccgccagggtcgcgctcgccaagcgcgtgccgcccggcaccggggtctcctac
gcccaccgctacgtcaccgactccgagacgacgctcgcgctcgtcccgctgggctacgcc
gacggggtgccgcgcgcggcgacgaacctcggcgaggtgctgctcgccgggcgtcgccgg
cggatcgccggcacggtctgcatggaccagttcgtcctcgacgtcggcgacgaccaggtc
gccgagggcgacgaggcggtgctgttcggccccggcgacgccggcgagccgaccgcggac
gactgggccgccgcgctcggcaccatcaactacgagatcgtcacccggatcggcccccgc
gtcccccggatctacctcaacccctga

DBGET integrated database retrieval system