KEGG   Frankia inefficax: FraEuI1c_7069Help
Entry
FraEuI1c_7069     CDS       T01354                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
fri  Frankia inefficax
Pathway
fri00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FraEuI1c_7069
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     FraEuI1c_7069
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     FraEuI1c_7069
    1.1.1.-  
     FraEuI1c_7069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Neisseria_PilC ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADP85034
UniProt: E3IXD4
LinkDB All DBs
Position
complement(8633573..8634625)
Genome map
AA seq 350 aa AA seqDB search
MIAARLHGPQDIRIEDIPEPEPGAGEVKLAVAHNGLCGTDLAEFFAGPRACTTVPHPLTG
GVLPQVMGHEFAGVVAAVGAGVADVAVGDQVCVEPLYSCGDCDRCHAGLPQLCRQVMTHG
ICSHGGGLAGFTVVPATMVHRLPASMSLAEGALVEPMSVAFNGVLRSGVEPGQSAVVFGA
GPIGIGVMFGLRAVGVEDILLVEPAPARRAAVAALGVADVLDPEATDVADEVRRRTAGRG
VDVAVDCAGAAATFAAAPAVLRARGRYVGIAFSGQAVSFTPWVLTRSEIELTGSLGYAPG
VFARVIDLMAGGAFPTKGWVEQVGLDELREVFDDLRAGRRLKILVDLPTG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggcaaggttgcacggcccgcaggacatccggatcgaggacatacccgaaccg
gaaccgggagcgggcgaggtgaagctggccgtggcgcacaacggcctgtgcggtaccgac
ctggccgagttcttcgcgggtccgcgggcctgcacgaccgtgccacacccgctgaccggc
ggcgtccttcctcaggtcatgggtcacgagttcgccggcgtcgtggccgcggtcggcgcg
ggcgtcgccgacgtcgcggtcggagaccaggtctgcgtcgagcccctttactcctgtggt
gattgcgaccgctgccacgccgggctgccgcagctgtgccggcaagtgatgacgcacggg
atctgctcgcacggcggtgggctggccggattcacggtggtgccggcgacgatggtgcat
cgacttccggcgtcgatgtcgctggccgaaggcgccctcgtggagcccatgtcggtggcg
ttcaacggggttcttcgttccggcgtcgaaccgggccagtccgcggtggtgttcggcgcc
gggccgatcgggatcggcgtcatgttcggcctgcgggccgtcggggtcgaggacattctt
ctggtcgagcccgcgcccgctcggcgagcggcggtcgccgcgctcggtgtcgcggacgtc
ctcgatccggaagccacggacgtggcggacgaggtgcgccgccgcacggcgggtcggggc
gtcgacgtcgcggtggactgtgccggcgccgcggccaccttcgcggcggctcctgccgtt
ctccgggcccgcgggcggtatgtcggcatcgccttttccggacaggcggtctccttcacc
ccgtgggtgctgacccgttcggagatcgagctcaccggttcactgggatatgcccccggt
gtcttcgcccgggtgatcgacctcatggccggcggtgcctttccgacaaagggctgggtc
gagcaggtcggtctcgacgagctgcgcgaggtcttcgacgacctgcgggccggccgtcgc
ctgaagatcctcgtagacctcccgaccggctga

DBGET integrated database retrieval system