KEGG   Francisella sp. MA067296: BBG19_0783Help
Entry
BBG19_0783        CDS       T05204                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
frm  Francisella sp. MA067296
Pathway
frm00550  Peptidoglycan biosynthesis
frm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBG19_0783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:frm01002]
    BBG19_0783
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:frm01011]
    BBG19_0783
Enzymes [BR:frm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BBG19_0783
Peptidases [BR:frm01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BBG19_0783
Peptidoglycan biosynthesis and degradation proteins [BR:frm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BBG19_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 PBP5_C DUF3221
Motif
Other DBs
NCBI-ProteinID: APC91519
LinkDB All DBs
Position
complement(800338..801660)
Genome map
AA seq 440 aa AA seqDB search
MKLTKIALLTAGLTASNVFAALNISAGSDPYFNSGNGIMQKDIIVRPANIELDAPAWVAM
NYRTGDIVSEKNMDVRRAPASLTKIMTSYIVASEIKAGNLSWDTMIPISENAASTGGSKM
YVKAGAKVSVKNLVTGMDVVSGNDATIALAEYIGGTTAAFTDLMNQTAKAIGMNNTHFAN
PDGLPGGEQYTTAHDMALLARSYIYNFPEAYKVYDDKGLVWNATKQDSVSIADRKQCLPK
FDRSSGNVIESYTATDLDDQTKDKCSKLFPNGENFVLQNNRNRLLFTDEDVEGMKTGHTD
EAGYCLVSTTKEFIFVVLGTSSAAKRDSESAKLIRYALSRYENVLLYKANSPVTISADSI
SNAKAGQKITVASNQNIYKTVLKTYVPYLKQGIEFNPNLKAPIKTGQAVGNLVITLDDTK
EKIASVAVIAMNDISQKGWW
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaacaaaaatagctttattgacagctggtttaacagcaagtaacgtttttgca
gcccttaatatatctgctggttccgacccttattttaacagcggtaatggtataatgcaa
aaagatattattgtaagacctgcaaatatcgagctagatgctccagcatgggtagcgatg
aattatcgcactggtgatatcgttagtgaaaagaatatggatgtcagaagagctcctgca
agcttaactaaaatcatgacttcttatatagttgctagtgaaataaaagctggtaatcta
agctgggatactatgattccaattagtgaaaatgctgcttctacaggcggttcaaaaatg
tatgtcaaagctggtgctaaagtctctgtaaaaaatctagtaactggcatggacgtagtt
tccggtaatgatgctactattgctcttgctgagtatatcggtggcactacagcagcattt
actgatttgatgaatcaaacagcaaaagctattggtatgaataatactcattttgctaat
ccagatggtcttccaggtggcgagcagtatactactgctcacgatatggcattacttgca
agatcatatatatacaatttcccagaagcgtataaagtatatgatgataaaggcctagtt
tggaatgctacaaaacaagactcagtaagcatcgctgaccgtaaacaatgcttacctaaa
tttgatcgctctagtggaaatgtcatagagagctacacagccacagatcttgatgatcaa
actaaagataagtgtagtaagcttttccctaatggtgaaaattttgtgttacaaaacaat
agaaacagattgctattcacagacgaagatgttgagggtatgaaaacaggtcatactgat
gaggctgggtactgtctagtttccactactaaagaatttatttttgtagttcttggcact
agtagtgctgctaagagagattcagagtcagccaagttaataagatatgcgctaagcaga
tatgaaaatgtacttttatacaaagcgaactcgccagttacaattagtgctgatagcatc
tcaaatgcaaaagctggacaaaagataactgtagcttcaaatcaaaacatttacaaaact
gtacttaaaacttatgtgccttatctaaaacaaggtatagaatttaacccaaacttgaaa
gcacctattaaaacaggacaagctgtaggcaatttagtgattacgttagatgataccaaa
gagaaaattgctagtgttgctgtaatagctatgaatgatatttcacaaaaaggttggtgg
taa

DBGET integrated database retrieval system