KEGG   Francisella sp. MA067296: BBG19_1232Help
Entry
BBG19_1232        CDS       T05204                                 

Definition
(GenBank) Biotin carboxylase of acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
frm  Francisella sp. MA067296
Pathway
frm00061  Fatty acid biosynthesis
frm00620  Pyruvate metabolism
frm00640  Propanoate metabolism
frm01100  Metabolic pathways
frm01110  Biosynthesis of secondary metabolites
frm01120  Microbial metabolism in diverse environments
frm01130  Biosynthesis of antibiotics
frm01200  Carbon metabolism
frm01212  Fatty acid metabolism
Module
frm_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:frm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBG19_1232
   00640 Propanoate metabolism
    BBG19_1232
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BBG19_1232
Enzymes [BR:frm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BBG19_1232
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BBG19_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp RimK GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: APC91964
LinkDB All DBs
Position
complement(1258619..1259971)
Genome map
AA seq 450 aa AA seqDB search
MIKKVLIANRGEIALRILRACRELGIKTVAVYSTADANLMHVKLADEAVCIGPPAPNLSY
LNIQAIITAAEITNADAIHPGYGFLSENAKFAKAVEESGFIFIGPRAESIEIMGDKVEAI
KYMKKAGVPCVPGSGGPLGSDEKKNLEIADKIGYPVIIKAAGGGGGRGMSIVRKKEDLIS
AISLTKSEARIAFNNDMVYMEKFLENPRHIEIQVFGDGKGNAVYLFERDCSTQRRHQKVI
EEAPAIGLTDEERKRIGEQCVSACKILKYRGAGTFEFLYEDGEFYFIEMNTRIQVEHPVT
ESITSTDLIKEQIRVANGEGLSWKQEDIVIVGHAIECRINAEDPERMIPSPGKIDMYHPP
AGPRVRVDSHIYSGYVVPPNYDSMIAKVIVRGHNRETALQKMRAALEEMVINGIKTNIPL
HQEILNNEVFIKGGTNIHFLEKLLEQKKAK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagtactgattgccaatagaggtgagatagcccttagaattttaagagct
tgtagagagttgggaattaagacagttgctgtgtattctacagctgatgctaatcttatg
catgttaaactagctgatgaagcagtttgtataggtcctcctgctcctaatcttagttat
ctaaatatccaagcaattataactgctgctgaaattactaatgctgatgcaatacatcca
ggttatggtttcttatcagaaaatgcaaaatttgctaaagctgttgaagaaagtggcttt
atattcatcggtccacgtgcagaaagcatagagataatgggtgataaagttgaagctatc
aaatacatgaaaaaagctggcgttccatgtgtaccaggttcaggtggtccgttaggaagc
gatgaaaagaaaaacttagaaattgctgataaaatcggctacccagttattatcaaagct
gctggtggtggcggtggtcgtggaatgagtattgttagaaagaaagaagaccttattagt
gctatttctctaacaaagagtgaagcaagaatagctttcaataacgatatggtgtatatg
gaaaaattcctagaaaatccacgtcatattgaaattcaagtttttggcgatggtaaaggt
aatgctgtatatctatttgaaagagattgctctactcaaagaagacaccaaaaagttatc
gaagaagctccagcaataggtcttactgatgaggaaagaaagcgtattggtgagcagtgc
gtcagtgcatgtaagatattaaaataccgtggtgcgggtacttttgaattcttgtatgag
gatggtgagttctacttcatcgaaatgaacactagaattcaggtagaacatcctgttact
gagtcgattacctctacagatcttatcaaagagcaaatcagagttgctaatggtgaaggt
ctaagctggaaacaggaagatatcgttatagtagggcatgcaatagagtgtagaataaat
gcagaagatcctgaaagaatgattccttcacctggtaagattgatatgtatcatccgcca
gcagggcctagagtgcgtgtggattctcatatatactcagggtatgttgtcccaccaaac
tatgactcaatgatcgctaaggttattgtgcgtggtcataacagagagacagcgttacag
aaaatgcgtgcagctttagaagaaatggtgattaatggtatcaagacaaatataccactt
catcaagagattctaaataatgaagttttcatcaagggtggaactaacattcacttctta
gaaaagctgctagaacagaaaaaagctaaataa

DBGET integrated database retrieval system