KEGG   Faecalibaculum rodentium: AALO17_18270Help
Entry
AALO17_18270      CDS       T04268                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
fro  Faecalibaculum rodentium
Pathway
fro00970  Aminoacyl-tRNA biosynthesis
fro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fro00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AALO17_18270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fro03029]
    AALO17_18270
Enzymes [BR:fro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AALO17_18270
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AALO17_18270
Mitochondrial biogenesis [BR:fro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AALO17_18270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey PhageMin_Tail Spore_GerAC
Motif
Other DBs
NCBI-ProteinID: AMK54961
UniProt: A0A140DWD4
LinkDB All DBs
Position
complement(1643106..1644530)
Genome map
AA seq 474 aa AA seqDB search
MSKYKTTIGIEIHCELKTGTKMFSGAPVKFGETANTCTSVVDLAMPGTLPSVNKEAVRLA
IKACTGLHCDIDPLVKFDRKNYYYSDLPKGFQITQQFHPIGRDGYVEIETEEGSKRIRIE
RIHMEEDTAKQFHRETGTYIDFNRAGVPLVEIVSRPDMHSAEEAAAYVDTLRQILLYLNV
SDVKMEEGSMRCDVNISLSADDSLGTKTEIKNLNSIANVQKAVAAEIERQSRILDEGGRV
EQATRRYDESQKTTVLMRKKEGAVDYKYFPEPNIFPIQLDEAWIRDIQDTMEELPAARRA
RFMKDYGLGEYDAQVLVADPAMADYYEEAAKTAKDAKKTANWVIGDLSAALNRDNRTFAN
AGVAPEHLAQLVNLVADGTISGKQAKTVFEDMLSSGKEPAKIVEEKGMKQVTDEGAILAL
VTEVLDANPKSIEDYKAGKDRAIGFLVGQVMKKSRGTANPKRTNELIREELAKR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtacaagaccaccatcggcatcgagatccactgtgagctgaaaacagggacc
aaaatgttctccggtgccccggtgaaattcggggaaacggcgaacacctgcacgagtgtg
gtggacctggcgatgcccggtacactgcccagcgtgaacaaagaggctgtccggctggcc
atcaaggcctgcaccggcctgcactgcgacattgatcccctggtgaagtttgaccggaag
aactactactattccgatctgcccaagggattccagatcacgcagcagtttcaccccatc
ggccgggacggctacgtggagatcgagacagaagagggatcgaagcggatccggatcgaa
cgcatccatatggaggaagacaccgcgaagcagttccaccgggaaacagggacgtacatc
gacttcaaccgggccggggtgcccctggtggaaattgtgtcccgtcccgatatgcattcg
gccgaagaagccgcagcctatgtggatacgctgcggcagatcctgctgtacctgaacgta
tcggatgtcaagatggaagaaggatccatgcggtgcgatgtcaacatttccctctctgca
gatgacagcctgggcacgaagaccgagatcaagaacctgaactccatcgccaatgtgcag
aaggccgtggcagcggaaatcgagcggcagagccggatcctggacgaaggcggccgggtg
gagcaggccacgcgccggtatgacgagagtcagaagacgacggtgctgatgcggaaaaag
gaaggggccgtggactacaagtatttcccggaaccaaacattttcccgatccagctggat
gaagcctggattcgggacatccaggacaccatggaagagctgccggcagcccgccgggca
cggttcatgaaggactatggactgggggaatacgatgcccaggtcctggtggccgatcct
gccatggcagactactatgaggaagctgcaaagacagcgaaagacgccaagaagaccgcg
aactgggtcatcggggatctgtccgctgctctgaaccgggacaaccgcacctttgccaat
gcaggggtggccccggaacacctggcgcagctggtgaacctggtggcggatggcaccatt
tccgggaagcaggccaagacggtgtttgaagacatgctttcttccgggaaggaaccggca
aagatcgtcgaggaaaagggcatgaagcaggtgacggatgaaggcgcgatcctggcactc
gtcaccgaagtgctggatgccaacccgaaatccatcgaagactacaaggcgggcaaggac
cgtgccataggctttctggtgggccaggttatgaagaagtccagagggaccgccaacccg
aagcggaccaatgagctgattcgtgaagaactggcaaaacgttag

DBGET integrated database retrieval system