KEGG   Frondihabitans sp. PAMC 28766: AX769_03440Help
Entry
AX769_03440       CDS       T04281                                 

Definition
(GenBank) hypothetical protein
Organism
frp  Frondihabitans sp. PAMC 28766
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AMM19358
UniProt: A0A126YWY7
LinkDB All DBs
Position
complement(701425..702726)
Genome map
AA seq 433 aa AA seqDB search
MSEGRADWSVQEVAAGRRAYRLVLLGTLVSALGEGLTLPFLFIYLHDVLGASLPLAGVVV
ALSAAAQIVATAVAGPLGDRFGLGRVVFVGLVVQAAGTALLASGVGLGGAVAAVALMGIG
EGSIWPGLNGLIAFQVPPAGRSRAYALRFGLNNGSLGLGALISGLIVSVADPGSFRMIYS
IDAGSTLVFALVVAIGLRRTPGFRPVTHRKPASLPLPKSASRAADRRGYWAVLTDRPFAA
YLVLGLAMGVFGYAQMNGPWAAFVTGAGGASTRIVGLGFAANTAVIVALQLPVERVTRRL
RRSRLLILTCLIWAAAWIMSGLAALPALHGPVGGVGFVVSLGVFGLGETFLSPVDGVIPN
DLAPDALRGRYNALAGSTLPVGGLIGPPLAGLILAGPMPGVWIVAIAGGAVACAAGAVVL
GRLLPARVERPAT
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagggtcgcgccgactggtcggtgcaggaggtcgccgctggtcgtcgggcgtac
cggctggtgctgctcggcacgctcgtctcggcactcggcgagggcctgacgctgcccttc
ctgttcatctacctgcacgacgtgctcggggcgagcctgccgctggccggtgtcgtggtg
gccctgtcagccgccgctcagatcgtggcgaccgcagtggccggcccgctgggcgaccgg
ttcggtctcggccgcgtcgtattcgtcgggctggtcgtgcaggccgcgggcacggcgctg
ctcgcttcgggggtcgggctcgggggcgcggtcgccgccgtcgcgctgatggggatcggc
gaggggtcgatctggccgggcttgaacggcctgatcgcctttcaggtcccgcccgcgggt
cggtcgcgggcgtacgcgctgcgcttcggcctgaacaacggcagcctgggcctcggcgcc
ctgatctccggcctgatcgtgtcggttgccgacccgggcagcttccggatgatctactcg
atcgacgcggggtcgaccctcgtcttcgcgctggtggtcgccatcggtctgcgccgcacg
ccggggttccgccccgtgacgcatcgaaagcccgcgtctcttccgctgccgaagtccgcg
tcgcgagcggcggaccggcgcggctactgggcggtgctgacggaccggcccttcgccgcg
tatctcgtgctcgggctggcgatgggtgtcttcggctacgcgcagatgaacggcccgtgg
gcggcgttcgtcacgggtgccggcggtgcgagcacccgcatcgtcgggctgggcttcgcg
gcgaacacggccgtgatcgtcgcactgcagctgccggtcgaacgcgtcacccggcgtctt
cgccgcagccgactgttgatcctgacctgcctgatctgggcggccgcctggatcatgagc
ggcctggccgcactgccggccctgcacgggccggtcggtggcgtcggcttcgtcgtctcg
ctcggagtcttcggcctcggcgagaccttcctcagcccggtcgacggcgtcatcccgaac
gacctcgcacccgacgctctccgcgggcggtacaacgcgctcgcggggtcgaccctcccc
gtcggtggcctgatcgggccgcccctcgccgggctgatcctcgcgggcccgatgcctggc
gtgtggatcgtggcgatcgcgggaggagcggtcgcctgtgccgcgggagccgtggtgctc
gggcgtctgctgcccgcacgcgtggagcggcctgcgacgtga

DBGET integrated database retrieval system