KEGG   Frondihabitans sp. PAMC 28766: AX769_04690Help
Entry
AX769_04690       CDS       T04281                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
frp  Frondihabitans sp. PAMC 28766
Pathway
frp00010  Glycolysis / Gluconeogenesis
frp00030  Pentose phosphate pathway
frp00051  Fructose and mannose metabolism
frp00052  Galactose metabolism
frp00680  Methane metabolism
frp01100  Metabolic pathways
frp01110  Biosynthesis of secondary metabolites
frp01120  Microbial metabolism in diverse environments
frp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:frp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AX769_04690
   00030 Pentose phosphate pathway
    AX769_04690
   00051 Fructose and mannose metabolism
    AX769_04690
   00052 Galactose metabolism
    AX769_04690
  09102 Energy metabolism
   00680 Methane metabolism
    AX769_04690
Enzymes [BR:frp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AX769_04690
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AX769_04690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AMM19566
UniProt: A0A126YXX7
LinkDB All DBs
Position
complement(957356..958384)
Genome map
AA seq 342 aa AA seqDB search
MRIGILTSGGDCPGLNAVIRGAVLKGIQIHGQEFVGFRDGWRGVVEDDLVELVRKDIQGI
SKQGGTILGTSRTNPFEGDKGGVENIARTLERRGIDAMIAIGGEGTLAAAKRLTDAGLKI
VGVPKTVDNDLGATDYTFGFDTAVQIAVDAMDRLRTTGDSHSRCMVAEVMGRHVGWIALH
SGMAAGAHAILIPEQATSVEQLAEWVRSAYDRGRAPLVVVAEGFVPDHENDAHSERGLDA
FGRPRLGGIGERLAPLIEELTGIETRATTLGHIQRGGTPSAYDRVLATRLGMAASDSVVE
GRWGRMVALRGTDIVHVSLEEALGSLKVVPQDRYDEAAILFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcggaatcctcacctcgggcggcgactgccccggcctcaacgcggtcatccgc
ggcgccgtgctgaaaggcatccagatccacgggcaggagttcgtcggattccgcgacggc
tggcgcggagtggtcgaggacgacctcgtcgagctggttcggaaagacatccagggcatc
tcgaagcagggcggcacgatcctcggcacgagccgcacgaaccccttcgagggcgacaag
ggcggggtggagaacatcgcccgcaccctcgagcgccgcggcatcgacgccatgatcgcg
atcggcggcgagggcacgctggctgcggcgaagcgcctcaccgacgccggcctcaagatc
gtgggagtgccgaagacggtcgacaacgacctcggcgcgaccgactacacgttcggcttc
gacaccgccgtgcagatcgccgtcgacgcgatggaccgcctgcgcaccacgggcgactcg
cacagccgctgcatggtcgccgaggtcatgggccgccacgtcggctggatcgcactgcac
tcgggaatggccgccggggcgcacgccatcctgatccccgagcaggccacgagcgtcgag
cagctcgccgagtgggtgcggtcggcctacgaccgcggccgcgccccgctcgtcgtcgtc
gccgagggcttcgtgcccgaccacgagaacgacgcccactccgagcgcggcctcgacgcc
ttcgggcggccccggctcggcggcatcggcgaacggctcgcaccgctgatcgaagagctc
accggcatcgagacccgtgccaccaccctcgggcacatccagcgcggcggcaccccgtcc
gcctacgaccgggtgctcgcgacgcgactcggcatggccgccagcgactcggtcgtcgag
gggcgctggggccggatggtggcgcttcgcggcaccgacatcgtgcacgtctcgctcgag
gaggcactcggctcgctgaaggtcgtgccgcaggatcgctacgacgaggccgcgatcctg
ttcggatag

DBGET integrated database retrieval system