KEGG   Frondihabitans sp. PAMC 28766: AX769_06490Help
Entry
AX769_06490       CDS       T04281                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
frp  Frondihabitans sp. PAMC 28766
Pathway
frp00020  Citrate cycle (TCA cycle)
frp00480  Glutathione metabolism
frp01100  Metabolic pathways
frp01110  Biosynthesis of secondary metabolites
frp01120  Microbial metabolism in diverse environments
frp01130  Biosynthesis of antibiotics
frp01200  Carbon metabolism
frp01210  2-Oxocarboxylic acid metabolism
frp01230  Biosynthesis of amino acids
Module
frp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:frp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AX769_06490
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AX769_06490
Enzymes [BR:frp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AX769_06490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AMM19869
UniProt: A0A126YXX9
LinkDB All DBs
Position
1322858..1325068
Genome map
AA seq 736 aa AA seqDB search
MSKIIYTLTDEAPRLATYSFLPIIEAYAAKAGVDVETRDISLAARILAHFPERLTDAQRV
PDTLAELGDLAETPEGNIIKLPNISASVPQLKAAIVELRSQGFDLPDYPDEPTSDEDKDV
RARYDKVKGSAVNPVLRQGNSDRRAPASVKQYARKHPHRMGAWSPDSKTNVATMGVDDFR
SSEKSVIVPAATSAKIEFTGDDGTVTALRDGIALKEGEVIDATVMRVGPLREFLKAQIAR
AAADDVLFSVHLKATMMKVSDPIIFGHAIRAFFDDVFEKYGADLAAAGLNPNDGLNAIYN
GLESLSNGAEIRAAFDAAIAAGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGHMW
GPDGAEHDTLAVIPDSSYAGIYQATIDDCRAHGAFDPATMGSVPNVGLMAQAAEEYGSHD
KTFEAPGTGTIRVIDASGATLLEHAVSSGDVWRMCQTKDAAIRDWVKLAVTRARASQTPA
VFWLDETRAHDSVLIGLAKTYLADYDTAGLTIEILSPVDAIDYSLERIRRGEDTISVTGN
VLRDYLTDLFPIMELGTSAKMLSIVPLLNGGGLFETGAGGSAPKHVQQLVKEDYLRWDSL
GEFLALAASFEHLATTTDNARAQILADTLDKATATFLDENKSPSRSVGSIDNRGSHYYLA
LYWAQEIAKQTVDAELAADFAALAKLLAESEETITAELIAPQGHPVDIGGYYRPDDAKAS
AIMRPSETLNGALASL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcatctacaccctgaccgatgaggcgccgcgactcgcgacctactcgttc
cttcccatcatcgaggcgtacgcggcgaaggcgggtgtcgacgtcgagacccgcgacatc
tcgctcgcagcccgcatcctggcgcacttccccgagcgtctcaccgacgcccagcgcgtg
cccgacaccctggccgagctcggcgacctcgccgagacacccgagggcaacatcatcaag
ctgcccaacatctcggcatcggtgccgcagctgaaggccgcgatcgtcgagctgcgctcg
cagggcttcgacctgcccgactaccccgacgagccgacctccgatgaggacaaagacgtc
agggcgcgctacgacaaggtcaagggctcggccgtcaaccccgtgctgcgccagggcaac
tccgaccgccgcgcacccgcgtcggtcaagcagtacgcccgcaagcacccgcaccgcatg
ggcgcgtggagccccgactcgaagacgaacgtcgcgaccatgggcgtcgatgacttccgc
tcgagcgagaagtcggtcatcgtgccggccgcgacgagcgcgaagatcgagttcaccggc
gacgacggcacggtcacggcgctgcgcgacggcatcgcgctgaaagagggcgaggtcatc
gacgccaccgtcatgcgcgtcggtccgctccgcgagttcctgaaggcccagatcgcccgc
gccgctgcggacgacgtgctgttctcggtgcacctcaaggccacgatgatgaaggtctcc
gacccgatcatcttcggccacgcgatccgcgccttcttcgacgacgtcttcgagaaatac
ggcgccgacctcgccgccgccggtctcaacccgaacgatggcctgaacgccatctacaac
ggcctcgagtcgctgtcgaacggcgcagagatccgtgccgccttcgacgccgcgatcgcc
gccggccccgccctggcgatggtcgactccgacaagggcatcaccaacctgcacgtgccg
agcgacgtcatcgtcgacgcgtcgatgcccgcgatgatccgcacctcgggtcacatgtgg
ggcccggacggcgccgagcacgacacgctcgccgtcatccccgactcgagttacgccggc
atctaccaggcgaccatcgacgactgccgcgcccacggtgcgttcgacccggccacgatg
ggctccgtgcccaacgtcgggctcatggcccaggcagccgaagagtacggctcgcacgac
aagaccttcgaggccccgggcaccggcacgatccgcgtcatcgacgcctcgggcgccacc
ctgctcgagcacgccgtctcgtcgggcgacgtgtggcgcatgtgccagacgaaggacgcc
gccatccgcgactgggtcaagttggccgtcacccgtgcccgcgcgtcgcagacgcccgcc
gtgttctggctcgacgagacccgggctcacgactccgtcctcatcggcctcgcgaagacg
tacctcgccgactacgacaccgcgggcctcacgatcgagatcctgtcgccggtcgacgcg
atcgactactcgctcgagcgcatccgccgcggcgaagacacgatctcggtgaccggcaac
gtgctgcgcgactacctcaccgacctgttcccgatcatggagctcggcacgagcgccaag
atgctgtcgatcgtgccgctgctgaacggtggcgggctgttcgagaccggcgccggcggc
tccgcgccgaagcacgtgcagcagctggtgaaggaggactacctgcgctgggacagcctc
ggcgagttcctcgcgctggccgcgagcttcgagcacctggcgaccacgacggacaacgcc
cgcgcgcagatcctggccgacacgctcgacaaggccacggccaccttcctcgacgagaac
aagtcgccgtcgcgttcggtcggctcgatcgacaaccgaggcagccactactacctcgcc
ctctactgggctcaggagatcgccaagcagacggtcgacgccgagctggcagccgacttc
gctgcgctggcgaagctgctggccgagtcggaggagacgatcaccgccgagctcatagcc
ccgcagggtcaccccgtcgacatcggcggctactaccgccccgacgacgccaaggcgagc
gcgatcatgcgccccagcgagacgctcaacggggcgctcgccagcctctag

DBGET integrated database retrieval system