KEGG   Frondihabitans sp. PAMC 28766: AX769_11895Help
Entry
AX769_11895       CDS       T04281                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
frp  Frondihabitans sp. PAMC 28766
Brite
KEGG Orthology (KO) [BR:frp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:frp01001]
    AX769_11895
Enzymes [BR:frp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AX769_11895
Protein kinases [BR:frp01001]
 Serine/threonine kinases: Other
  Bacterial family
   AX769_11895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Haspin_kinase Pkinase_fungal FTA2
Motif
Other DBs
NCBI-ProteinID: AMM20715
UniProt: A0A126Z2M9
LinkDB All DBs
Position
complement(2468493..2470508)
Genome map
AA seq 671 aa AA seqDB search
MSASQSDPMIGRLIDGRYQVRSRIARGGMATVYLASDLRLERPVAVKIMHGHLADDENFK
ERFIQEARSAARLAHPNVVNVFDQGQDDESAYLVMEYLPGITLRELLQDHKMLTPEQATD
ILEAVLAGLAAAHKSGIVHRDLKPENVLLADDGRIKIGDFGLARAASANTATGAALLGTI
AYLSPELVTRGIADTRSDIYALGIMLYEMLTGEQPYKGEQPMQIAYQHANDTVPMPSAVN
PRVPPELDELVLWATARDPDQRPRDARAMLEHLFELQRGGSGGSPLNKTMVLPPAMAPVP
PLQRSTGPTGPVASGGTGDTMVLQKARHRTGPVAPALSTNAEALSRKAGSRRRRGLVWLI
VLIVLALLAAGTGWWFNAGPGANATVPRIASTSIPDATARLKSAGFTVAAAQTGVYSVQI
PSGQVAGTRPAGGATVHKGSSVTLIVSKGPQILPLPTTLGQQETAAKALLKNFTVEASQY
QFGTQASGVVIGVTGKDSSGKAVDIGQAKTYPDKQPVTLTVSLGPVPNVVGQSLSNAQAT
LSNVNLTGADTSDVFSDTVASGVVISQAQAKAGSVHKGDTINLTVSKGPAPITVPDETGK
KVSAAEAALTALGLKVTYANCTTAECITANALGFDWRKLVKVSSQSPAGSAIAHKGDTIT
LQYDGSKVSIG
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccagccagagcgacccgatgatcggtcgcctcatcgacggccggtaccaggtg
cgctcacgcatcgcccgcggcggcatggcgacggtctacctcgccagcgacctccggctc
gagcggcccgtcgccgtcaagatcatgcacggccacctcgccgacgacgagaacttcaaa
gagcgcttcatccaggaggcccgctcggccgcccgcctcgcgcaccccaacgtcgtcaac
gtcttcgaccaggggcaggacgacgagtcggcctacctggtgatggagtacctgcccggc
atcacactgcgcgaactgctgcaggatcacaagatgctcaccccggagcaggcgaccgac
atcctcgaggcggtgctggccgggctcgcggcggcgcacaagtcgggtatcgtgcaccgc
gacctgaagcccgagaacgtgctgctcgccgacgacggccgcatcaagatcggcgacttc
gggctcgcgcgcgcggccagcgcgaacacggcgaccggcgccgccctgctcggcaccatc
gcctacctctctcccgagctcgtcacccgcggcatcgccgacacccgcagcgacatctat
gcgctcggcatcatgctctacgagatgctcaccggcgagcagccctacaagggcgagcag
ccgatgcagatcgcctaccagcacgcgaacgacaccgtgccgatgccctcggcggtgaat
ccgcgcgtgccgcccgagctcgacgagctcgtgctgtgggcgacggcacgcgaccccgac
cagcgccctcgcgacgcccgggccatgctcgagcacctcttcgagctgcagcgcggcggc
tccggcgggtcgccgctcaacaagacgatggtgctgccacccgcgatggcccccgtgccg
ccgctccagcgctctaccggccccaccggccccgtcgcctccggaggcaccggcgacacg
atggtgctgcagaaggcccgccaccgcacgggccccgtcgcacccgccctgtcgaccaac
gccgaggccttgtcgcgcaaagccggctcgcgtcgccgtcgcggcttggtctggttgatc
gtcctgatcgtgctcgccctcctggccgcgggcaccggctggtggttcaacgccggcccg
ggcgccaacgcgaccgtgccgcgcatcgcgagcacgagcattccggatgccacggctcgc
ctgaagtcggcgggcttcacggtcgccgcggcccagaccggcgtgtacagcgtgcagatc
ccgagcgggcaggtggccggcacgcgccccgccggcggtgcgacggtgcacaaggggtcg
agcgtgacgctgatcgtatcgaagggcccgcagatcctgccgctcccgaccactctgggg
cagcaggagaccgcggcgaaggccctgctcaagaacttcacggtcgaggcgtcgcagtac
cagttcggcacccaagcgtcgggcgtcgtcatcggcgtgaccggcaaggactcgtcgggt
aaggccgtcgacatcggccaggcgaagacctaccccgacaagcagcccgtcacgctgacc
gtgtcgctcggcccggtgcccaacgtcgtcggccagtcgctgtcgaacgcgcaggcgacg
ctgtcgaacgtcaacctcaccggggccgacacgagcgacgtgttcagcgacacagtcgcc
tcgggcgtcgtcatcagtcaggcgcaggcgaaggccgggagcgtgcacaagggcgacacg
atcaacctgacggtgtcgaagggcccggcgccgatcaccgtgcccgacgagacgggcaag
aaggtctcagcggccgaggcggcgctcacggccctcggactgaaggtcacctacgccaac
tgcacgacggcggagtgcatcacggcgaacgccctgggattcgactggcgcaagctcgtc
aaggtgtcgtcgcagtcgcccgccggctcggcgatcgcgcacaaaggcgacacgatcacc
ctgcagtacgacggttccaaggtcagcatcggctag

DBGET integrated database retrieval system