KEGG   Frondihabitans sp. PAMC 28766: AX769_18345Help
Entry
AX769_18345       CDS       T04281                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
frp  Frondihabitans sp. PAMC 28766
Pathway
frp00020  Citrate cycle (TCA cycle)
frp00190  Oxidative phosphorylation
frp00650  Butanoate metabolism
frp01100  Metabolic pathways
frp01110  Biosynthesis of secondary metabolites
frp01120  Microbial metabolism in diverse environments
frp01130  Biosynthesis of antibiotics
frp01200  Carbon metabolism
Module
frp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:frp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AX769_18345
   00650 Butanoate metabolism
    AX769_18345
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AX769_18345
Enzymes [BR:frp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AX769_18345
    1.3.5.4  fumarate reductase (quinol)
     AX769_18345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO HI0933_like DUF573
Motif
Other DBs
NCBI-ProteinID: AMM22534
UniProt: A0A126Z7H9
LinkDB All DBs
Position
3831438..3833243
Genome map
AA seq 601 aa AA seqDB search
MPDSSTAPTKTVNGVHYHQHDIVIVGAGGAGMRAAIEAGPHASTAVISKLYPTRSHTGAA
QGGMAAALANVEEDNWEWHTFDTVKGGDYLVDQDAAEILAKEAIDAVLDLENMGLPFNRT
PEGKIDQRRFGGHTSEHGKSPVRRACYAADRTGHMILQTLYQNCVKFGINFFNEFYVLDL
IMAEVDGVSRPAGVVAYELATGELHVFQGKAVIFATGGFGKIYKTTSNAHTLTGDGVGIV
WRKGLPLEDMEFFQFHPTGLAGLGILLSEAARGEGAILRNSEGERFMERYAPTIKDLAPR
DIVARCIRTEIREGRGAGPNKDYVYLDITHLSPEVIDAKLPDITEFARTYLGVEPYTEPV
PILPTAHYAMGGIPTNVKAEVLRDNITPVPGLYAAGECACVSVHGSNRLGTNSLLDINVF
GKRAGNNAVEYVKTADFVPLPDDSAAFVQGLIEQVRTATGTERIATLRRELQESMDDNAQ
VFRTEETLNLVTDKIQELRERYLNISVQDKGKRFNTDLLEAIELGFLLDLAEVVVYSART
RTESRGGHFREDFPTRDDENWLVHTMAYLTGDAHSADAGDHIKLDTKPVVITNYQPMERK
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atccccgactcctccaccgccccgacgaagaccgtcaacggcgttcactatcaccagcac
gacatcgtgatcgtcggggccggcggcgccggcatgcgcgccgccatcgaagccggcccg
cacgcgtcgaccgccgtgatctccaagctctacccgacgcgctcgcacacgggtgccgcg
cagggaggcatggccgccgctctcgccaacgtcgaggaagacaactgggagtggcacacc
ttcgacaccgtcaagggcggcgactacctcgtcgaccaggacgccgccgagatcctcgcc
aaagaggccatcgacgccgtcctcgatctcgagaacatgggtctgccgttcaaccgcacc
cccgagggcaagatcgaccagcgtcgtttcggcggccatacctccgagcacggcaagtcg
cccgtgcgtcgcgcctgctacgcggccgaccgcaccggccacatgatcctgcagacgctc
tatcagaactgcgtcaagttcggcatcaacttcttcaacgagttctacgtgctcgacctg
atcatggccgaggtcgacggcgtctcgcgcccggcgggcgtcgtggcctacgagctcgcg
accggcgagctgcacgtcttccagggcaaggccgtcatcttcgcgaccggtggcttcggc
aagatctacaagaccacgtcgaacgcgcacaccctcaccggcgacggcgtcggcatcgtg
tggcgaaagggcctgccgctcgaagacatggagttcttccagttccacccgacagggctc
gcgggtctcggcatcctgctgtcggaggccgctcgcggcgagggcgccatcctccgcaac
agcgagggcgagcggttcatggagcgctacgccccgaccatcaaagacctcgctccgcgt
gacatcgtcgcccgctgcatccggaccgagatccgcgaaggtcgaggcgcgggcccgaac
aaagactacgtctacctcgacatcacccacctctcccccgaggtgatcgacgccaagctc
cccgacatcaccgagttcgcgcgcacctatctgggcgtcgagccgtacaccgagccggtg
ccgatcctgccgaccgcgcactacgcgatgggcggcatccccaccaacgtcaaggccgag
gtgctgcgcgacaacatcacgcccgtgcccggcctctacgccgccggcgagtgcgcctgc
gtgagcgtgcacggctcgaaccgcctcggcaccaactcgctgctcgacatcaacgtcttc
ggcaagcgcgccggcaacaacgctgtcgagtacgtcaagacggccgacttcgtgccgctg
cccgacgactccgcagctttcgtgcagggcctcatcgagcaggtccgtaccgcgaccggc
accgagcgcatcgcgaccctgcgccgcgagttgcaggagtcgatggacgacaacgcccag
gtcttccgcaccgaagagacgctcaacctcgtcaccgacaagatccaggagctgcgcgag
cgctacctcaacatctcggtgcaagacaagggcaagcgcttcaacaccgacctcctcgaa
gcgatcgagctggggttcctcctcgacctggccgaggtcgtcgtctactcggcgcgcacc
cgcaccgagagccgcggcggccacttccgcgaagacttcccgacgcgcgatgacgagaac
tggctggtgcacacgatggcctacctcaccggcgacgcgcactccgccgacgccggcgac
cacatcaagctcgacaccaaacctgtcgtcatcacgaactaccagccgatggaacggaag
tactga

DBGET integrated database retrieval system