KEGG   Frondihabitans sp. PAMC 28766: AX769_18350Help
Entry
AX769_18350       CDS       T04281                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
frp  Frondihabitans sp. PAMC 28766
Pathway
frp00020  Citrate cycle (TCA cycle)
frp00190  Oxidative phosphorylation
frp00650  Butanoate metabolism
frp01100  Metabolic pathways
frp01110  Biosynthesis of secondary metabolites
frp01120  Microbial metabolism in diverse environments
frp01130  Biosynthesis of antibiotics
frp01200  Carbon metabolism
Module
frp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:frp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AX769_18350
   00650 Butanoate metabolism
    AX769_18350
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AX769_18350
Enzymes [BR:frp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AX769_18350
    1.3.5.4  fumarate reductase (quinol)
     AX769_18350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_6 Fer4_18 Fer4_4 Fer4_15 Fer4_2 Fer4_21 Fer4_16
Motif
Other DBs
NCBI-ProteinID: AMM21748
UniProt: A0A126Z3I2
LinkDB All DBs
Position
3833245..3834000
Genome map
AA seq 251 aa AA seqDB search
MSNAVLEKAPEADAAITKFTATLSIRRFDPDVDDEPRWQEFQVEMLPTDRVLDALHQIKW
EQDGSLTFRRSCAHGVCGSDAMRINGRNRLACKTLMKDLDISKPVYVEAIKGLPLEKDLV
VDMDPFFASYREIQPFLQSSSKPDKERLQSDEQRARFDDTTKCILCAACTSSCPVFWTDG
QYFGPAAIVNAHRFIFDSRDEEAKVRLDILNDKEGVWRCRTTFNCTEACPRGIQVTQAIA
EVKAAVLRGRP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgcagtcctcgagaaggcgccggaagccgacgccgccatcaccaagttcacc
gccacgctgtcgatccgccgcttcgaccccgacgtcgacgacgagccgcgctggcaggag
ttccaggtcgagatgctgccgaccgaccgcgtcctcgacgctctgcaccagatcaagtgg
gagcaggacggctcgctgacgttccgtcgatcctgtgcccacggcgtctgcggttcggac
gcgatgcgcatcaacgggcgcaaccgcctcgcctgcaagacactgatgaaagacctcgac
atctcgaagccggtctacgtcgaggcgatcaagggtctgcccctcgagaaggacctcgtc
gtcgacatggacccgttcttcgcgtcgtaccgcgagatccagcccttcctgcagtcgtcg
tccaagccggataaagagcgcctccagtcggacgagcagcgcgcgcgcttcgacgacacc
acgaagtgcatcctctgcgccgcgtgcacctcgtcgtgccccgtcttctggacggacggc
cagtacttcggccccgctgcgatcgtcaacgcgcaccgcttcatcttcgactcgcgcgac
gaagaggccaaggttcgtctcgacatcctcaacgacaaagagggcgtgtggcgctgccgc
accaccttcaactgcaccgaggcgtgccctcgtggcatccaggtcacgcaggcgatcgcc
gaggtcaaggctgccgtgctccgcggccgcccgtag

DBGET integrated database retrieval system