KEGG   Frondihabitans sp. PAMC 28766: AX769_21430Help
Entry
AX769_21430       CDS       T04281                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
frp  Frondihabitans sp. PAMC 28766
Pathway
frp00010  Glycolysis / Gluconeogenesis
frp00071  Fatty acid degradation
frp00350  Tyrosine metabolism
frp00625  Chloroalkane and chloroalkene degradation
frp00626  Naphthalene degradation
frp01100  Metabolic pathways
frp01110  Biosynthesis of secondary metabolites
frp01120  Microbial metabolism in diverse environments
frp01130  Biosynthesis of antibiotics
frp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:frp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AX769_21430
  Lipid metabolism
   00071 Fatty acid degradation
    AX769_21430
  Amino acid metabolism
   00350 Tyrosine metabolism
    AX769_21430
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AX769_21430
   00626 Naphthalene degradation
    AX769_21430
Enzymes [BR:frp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AX769_21430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C PCMT CoA_binding
Motif
Other DBs
NCBI-ProteinID: AMM22689
UniProt: A0A126Z6C3
LinkDB All DBs
Position
p1:complement(160364..161398)
Genome map
AA seq 344 aa AA seqDB search
MKAAVVTAFSAPLEIVDRPIPEPAAGQVLIRLEACGLCHTDIHAAGGDWPVKPPLPIVPG
HEGIGIVEKLGDGVTDRAVGDRVAIAWLGEACGECRYCIDGRETLCEKQENSGYSIDGAF
AEYAVASAKYVVAVPDGITSLDAAPLSCAGLTTYKALKVAQVQPTEHVGIFGIGGLGHLA
VQYARIMGGTVVAIDIEQPKLDLAAELGAEHLVNAATSDPVEAIQALGGLDVAVVLAASP
KVFEQAFASLRRGGRLVCVALPADGTMSIPIFDTVIKGISIIGSIVGTRQDLAEVFALHA
AGKTRVIAETRALDDINEAIAEVLSGSIPARLVFEYSRVPATVS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagtcgtcaccgctttttccgcaccgctcgagatcgtcgaccggccgatt
cccgagccggcagcgggccaggtgctcatccggctcgaggcctgcggcttgtgtcacacc
gacatccatgccgccggcggcgactggcccgtcaagccgccgctcccgatcgtgcctggc
cacgagggaatcggcatcgtcgagaaactcggcgatggagtcaccgaccgcgccgtcggc
gaccgcgttgccattgcgtggctgggcgaagcgtgcggcgagtgccgctactgcatcgac
ggccgcgagaccctctgcgaaaagcaggagaacagcggctactcgatcgacggcgcgttc
gccgagtacgccgtcgccagcgccaagtacgtcgtcgccgtccccgacggcatcacgtct
ctcgacgccgcgccgttgagctgcgccggcctcaccacctacaaggcactcaaggtcgcg
caggtccagcccaccgaacacgtcggcatcttcggcatcggcggcctcgggcacctcgcc
gtgcagtacgcccggatcatgggcggcacggtggtcgcgatcgacatcgaacaacccaag
ctcgacctggcggccgagctcggtgctgagcacctcgtgaacgcagcgaccagcgatccg
gtcgaagcgatccaggcgctcggcggtctcgacgtcgccgtggttctcgccgcgtcaccg
aaagtgttcgagcaggccttcgcctcgcttcgccgtggcggccgcctcgtctgcgtcgcc
cttcccgccgacgggaccatgagcatccccatcttcgacaccgtcatcaagggcatctcg
atcatcggctcgatcgtcggcaccaggcaggatctcgccgaggtcttcgccctccacgcc
gctggcaagactcgtgtcatcgccgagacccgcgccctcgacgacatcaacgaggccatc
gccgaagtgctctcgggcagcatcccggcccgtctcgtcttcgagtacagccgcgtgccc
gcgaccgtgagctga

DBGET integrated database retrieval system