KEGG   Frondihabitans sp. PAMC 28766: AX769_22675Help
Entry
AX769_22675       CDS       T04281                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
frp  Frondihabitans sp. PAMC 28766
Pathway
frp00250  Alanine, aspartate and glutamate metabolism
frp00410  beta-Alanine metabolism
frp00430  Taurine and hypotaurine metabolism
frp00650  Butanoate metabolism
frp01100  Metabolic pathways
frp01110  Biosynthesis of secondary metabolites
frp01120  Microbial metabolism in diverse environments
frp02024  Quorum sensing
Module
frp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:frp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AX769_22675
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AX769_22675
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AX769_22675
   00430 Taurine and hypotaurine metabolism
    AX769_22675
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AX769_22675
Enzymes [BR:frp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AX769_22675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMM22945
UniProt: A0A126Z932
LinkDB All DBs
Position
p3:complement(57715..59106)
Genome map
AA seq 463 aa AA seqDB search
MQTLTKTTGPRDNVTLNPLFARPGEDTVAPKYQLGEGQMLPETAYQIVHDEAMLDGNARL
NLATFVGTWMDDHANRLYAETFDKNMIDKDEYPQTAEIEVNCWRILADLWHAPDPAGAMG
TSTVGSSEACMLGGLALKRRWQQARRAAGKSTDRPNMVMSSAVQVCWEKFCNYWDIEPRY
VPITEDHKTFDGHNLAAYVDENTIGVVAILGVTYTGMYEPVTQIANALDDIQANTGLDIA
IHVDAASGGMIAPFLQPDLEWDFRLERVHSISTSGHKYGLVYPGLGWVIWRTADLLPEDL
IFKVSYLGGDMPTFALNFSRPASQVLLQFYLFLRLGRDGYTQVQQASQDVAKHLARGIAN
LGPFDLWNDGSDIPVFAWRLKDDPTRNWNLYHLSDRLRTEGWLVPAYPMPADLTNITVQR
IVVRNGLSMDLADRFLVDMAKQTDYLERLESPMPLEAQPSFHH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atacaaaccttgacgaaaactacaggtccccgcgacaacgtgaccctgaacccgttgttc
gctcgccccggcgaggacacggtcgccccgaaataccagcttggtgaggggcagatgctg
cccgagacggcgtaccagattgtgcatgacgaagcgatgctcgacggtaatgcgaggctg
aaccttgccacgttcgtggggacctggatggatgatcacgcgaaccggctttacgccgag
acgttcgataagaacatgatcgataaggacgagtacccgcaaacagcggagattgaggtg
aattgctggcggatacttgccgacctgtggcatgcacccgaccctgctggtgcgatgggg
acgtcgacggtgggctcctccgaagcgtgcatgcttggcgggctggcactgaaacggcgg
tggcagcaggcgcgaagggcggccgggaaatcgacggaccgaccgaacatggtgatgagt
tctgcggtgcaggtgtgctgggagaagttctgcaactactgggacatcgaaccccgctat
gttccgatcacggaagaccacaaaacgttcgacgggcataacctcgcggcgtatgtcgat
gagaacacgattggtgtcgtcgcgattttgggtgtcacctacacggggatgtacgagccg
gtgacacagatcgccaacgcgctcgacgacattcaggcgaacaccgggcttgatattgcc
atccatgtggacgctgcttccggcgggatgatcgccccgttcctgcaaccggatctggaa
tgggattttcgtctggaacgggtgcactccatcagtacctccggtcacaaatatggtctc
gtctacccaggtcttggttgggtcatctggcggaccgcggacctgttgcctgaggacctg
attttcaaggtcagctacctgggcggtgacatgccgacgttcgcgttgaacttctcccgc
cccgcttcccaggtgctgctgcagttctacctgttcctccggctggggcgagatggatac
acccaggtgcagcaggcctcgcaggacgtcgccaaacacctcgcccgaggtatcgccaac
ctcggccccttcgacctctggaacgacggaagcgacatccccgttttcgcctggcggctg
aaagatgacccgaccaggaactggaacctctaccacctctcagaccggctccgcacagaa
ggatggctcgtcccggcttatccgatgccagctgacctcaccaacatcacggtgcagaga
atcgtggtgcgcaacggcctgagcatggacctcgccgaccggttcctggtcgatatggcc
aagcaaaccgactacctggagcggctggaatccccgatgcctctcgaggcgcaaccgtct
ttccaccactag

DBGET integrated database retrieval system