KEGG   Francisella sp. TX077308: F7308_0154Help
Entry
F7308_0154        CDS       T01560                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
frt  Francisella sp. TX077308
Pathway
frt00473  D-Alanine metabolism
frt00550  Peptidoglycan biosynthesis
frt01100  Metabolic pathways
frt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:frt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    F7308_0154
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F7308_0154
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    F7308_0154
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:frt01011]
    F7308_0154
Enzymes [BR:frt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     F7308_0154
Peptidoglycan biosynthesis and degradation proteins [BR:frt01011]
 Precursor biosynthesis
  Amino acid ligase
   F7308_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 RimK ATP-grasp ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AEI35082
UniProt: F8G7W6
LinkDB All DBs
Position
159025..159918
Genome map
AA seq 297 aa AA seqDB search
MQKEKIVVLYGGDSPEREVSLKSGKAVLDSLLNQGYDASGLDASSKDLVTKLIELNPDKC
FIALHGEDGENGRVAALLEMLGIKHTGSTMKSCVITMDKMISKEIWMHHRMPTPMAKFLT
DKLVESDEISFPVAVKPSNGGSSIATFKVKNFKELEEAYKQASEHGEVMIEQWVTGKEIT
VAIVNNDVYSSVWIEPLNEFYDYESKYSGKSIYHAPSGLCEQKELEVRQLAKKAYDLLGC
KGHARVDFIYDDRGDFYIMEINSSPGMTENSLSPKSAAAEGIDFDSFVKSILEQAQC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagaaaaaattgtcgttctatatggtggggactctccagaaagagaagtatct
ctgaaatctggtaaagcagttttggattctttactaaatcaaggctatgatgcgtctggc
ttagatgcaagctcaaaagatttagttactaaacttatagagctaaatcctgataagtgt
tttattgcattgcacggtgaagatggcgaaaatggtagggtagcagcattgcttgaaatg
ctaggcattaagcatactggctcaactatgaaatcatgtgtcataactatggataaaatg
atctcgaaagaaatatggatgcaccatcgtatgcctacacccatggcaaagttccttaca
gataaattagtggaatctgatgagattagttttcctgttgcagttaaaccaagtaatggt
ggatctagtatagctactttcaaagtaaaaaattttaaagagcttgaggaggcatataaa
caagcttcagagcatggtgaagtaatgattgagcaatgggttactggtaaagaaataact
gtagctattgttaataatgatgtttactcatctgtctggatcgagccattgaatgagttc
tatgactatgagtcaaaatatagcggtaagtcaatatatcatgcacctagtggattatgt
gagcaaaaagagctagaagttcgccagttagccaaaaaagcctatgacctattggggtgt
aaaggacatgctcgagtcgattttatatatgatgatagaggagatttttatattatggaa
ataaactcatcaccaggtatgacagagaatagtttatctccaaagtcagcggcagctgag
gggattgattttgatagctttgttaaatcaatattagaacaggcacaatgctaa

DBGET integrated database retrieval system