KEGG   Francisella sp. TX077308: F7308_1261Help
Entry
F7308_1261        CDS       T01560                                 

Definition
(GenBank) Beta-lactamase class C-like penicillin binding protein
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
frt  Francisella sp. TX077308
Pathway
frt00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:frt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F7308_1261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:frt01002]
    F7308_1261
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:frt01011]
    F7308_1261
Enzymes [BR:frt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     F7308_1261
Peptidases and inhibitors [BR:frt01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   F7308_1261
Peptidoglycan biosynthesis and degradation proteins [BR:frt01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   F7308_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AEI36187
UniProt: F8G778
LinkDB All DBs
Position
complement(1296636..1297790)
Genome map
AA seq 384 aa AA seqDB search
MDFQNLENIINHDISHGFSGVAVNVVFHNKPIYKNNFGYAYRYNQEGNLVSNPQSLRDNM
LFDIASLTKIFATTYAVMYLYERKKIKLDDKITKYIPEFKFENTSYIPTIRDLLNHATGV
APFFDFYNNHIADSLYSQDRETTIRFLKTKMSVIEPAQKYCIYSDIGMKILGCLIETITN
QRMDDFLEKNIYSKAGAQNTCFNPLEKGYLPNQIVATQIDGHTNCGTTNFNNIKTDTLRG
LVHDEKALYSMSGIAGHAGLFSTIDDITKLAGLLYQENTFFTQGTIKEFSQPSNINPSFG
LGFWTANGRKNRPFFGEKCSDQTIGHTGFTGQCFISDSQNKITIIIMSNSVHSPIIYPRI
FEGKTYRTGMYGQLIDSIYTELDL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggattttcaaaatttagaaaatattattaaccatgatatttcacatggcttctcagga
gtagctgtgaatgtggtttttcataacaaacctatttataaaaataattttggttacgca
tatagatataatcaagaaggaaatcttgtcagtaacccacaatctttaagagataatatg
ctttttgatatagcttctctgacaaaaatttttgcaaccacttatgcagtcatgtactta
tatgagcgaaaaaaaatcaaactagatgataagataacaaaatatattccagagtttaaa
tttgagaatacctcttatatcccaactattcgagatttattaaatcatgctactggtgta
gctccgttttttgatttttataataatcatattgcagattctctatatagccaagacaga
gaaactactatcagattcttaaaaacaaagatgtctgtcattgaaccagcacaaaagtat
tgtatctactcagatataggtatgaaaatattaggatgtttaattgagactataactaat
caaagaatggatgattttctagaaaaaaatatctattcgaaagccggtgctcaaaatacc
tgttttaatcctttggaaaaaggctatttaccaaatcaaatagtagcaactcaaattgac
ggccatactaattgtggtactactaattttaataatataaaaactgatactcttcgaggc
ttagttcacgatgaaaaagcactctactcaatgagcggtattgctggtcatgcaggatta
ttttctactattgacgacattaccaaactagcaggcctgttatatcaagaaaatacattt
tttactcaaggcaccataaaagaatttagtcaaccatctaacattaacccttcttttgga
ttagggttttggacagcaaatggacgcaaaaacagacctttttttggtgaaaaatgtagt
gatcaaactataggacatactggatttacaggtcaatgctttatttctgattctcaaaat
aagattaccattataattatgtcgaacagtgtgcatagtcctattatctatcctagaatt
tttgaaggcaaaacttatagaacaggcatgtatggacaattaatagactcgatatatacg
gagttagatttatga

DBGET integrated database retrieval system