KEGG   Francisella sp. TX077308: F7308_1426Help
Entry
F7308_1426        CDS       T01560                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
frt  Francisella sp. TX077308
Pathway
frt00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:frt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F7308_1426
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:frt01002]
    F7308_1426
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:frt01011]
    F7308_1426
Enzymes [BR:frt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     F7308_1426
   3.4.21  Serine endopeptidases
    3.4.21.-  
     F7308_1426
Peptidases and inhibitors [BR:frt01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   F7308_1426
Peptidoglycan biosynthesis and degradation proteins [BR:frt01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   F7308_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AEI36351
UniProt: F8G854
LinkDB All DBs
Position
1455061..1456464
Genome map
AA seq 467 aa AA seqDB search
MIKRTKLLVAISIFVASANLSYASTRSEIQSLVKKYNLSNAKIAVAAQRTMTGADLYAYA
ENRSMKPASNNKVFTIVSGLFAIPSNFRFTTTVMYPSNRISNHTLYGDMYIKFTGNPALT
GSQLSSLIRKIKTEKGISKITGDVYLVGVFSGPYIPRGWSKEDKTLCYGAPASSFTLNRN
CTVIKLVKNPNSLTTRVVELSNASNIDIKNSAKYTSATKATILSMNDDNVVYISGYLSRT
AEKMFKLAIRNPALKTVDTVNDFLSSSGVKHGKVLIASDIPAGYESQITTRSATIGHFFD
QTLKHSDNLYAETILNTIGLQEKGIGSTKAGTEAVQSILYSKLGLDTSALTMYDGSGLSH
LDRVSPEFMVDFLTKTFNSKVGKQFYNYLPSSGISGTIAYRMGGKLLGRVHAKTGTLSGV
STLSGYVLTAKNHRISFSIMLNDLKYSDRYNARRFQDKVVDVFYRNL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaaagaactaagcttttagtagctatatctatatttgtagcaagcgcaaaccta
tcttacgcatctactcgtagcgaaatacaatctcttgtaaaaaagtataacttatctaat
gctaaaattgctgtagcagcccaaagaactatgacaggtgctgatctgtatgcctatgct
gaaaacagatcaatgaaacctgcaagtaataataaggtatttacaatcgtctcaggatta
tttgctattcctagtaactttagatttacaactactgttatgtatccatctaatagaata
tcaaaccatactctctatggtgatatgtatataaaatttactggtaatccagcccttacg
ggtagtcagttatcatcattgataagaaagataaaaacagaaaaaggaatatctaaaatt
acaggcgatgtatatcttgttggtgtattttcaggaccatatatccctaggggttggtct
aaagaagataaaacattatgctatggtgcaccggcttctagctttacattaaatagaaac
tgtactgttataaaactagttaaaaatccaaatagtttaactactagagttgtagagctt
agcaatgctagcaacattgacataaaaaattcagctaaatatacaagtgcaacaaaggct
acgattttatcaatgaatgatgataacgtggtatatataagtggatatttatctagaaca
gctgaaaaaatgtttaaactggcaattagaaaccctgctttaaagacagtagatactgtt
aatgattttttaagttctagtggagtaaaacatggtaaggtacttattgctagtgatatt
ccagctggttatgaatcacaaataacaacaagatcagcaacaattggacacttctttgac
caaactcttaaacactctgacaatttatatgcagaaactatactaaatactattggttta
caagaaaaaggaattggctcaactaaagcgggtactgaagctgttcaaagcatcttatat
tcaaaactaggattagacacgtctgctttgactatgtatgacggatctggattatcacat
ctggatagagttagtcctgaatttatggttgatttcttgactaaaacttttaacagtaaa
gttggtaaacaattctataattacctaccttcatctggaataagtggtaccatcgcatat
agaatgggaggcaaactgcttggtcgagtacatgcaaaaacaggtacattatctggagta
tcaacactatcaggctatgttttaactgcaaaaaaccatcgcatctcattttcgatcatg
ctaaatgatctcaagtactctgatcgttacaatgctcgtagattccaagataaagttgtg
gatgttttttataggaatttataa

DBGET integrated database retrieval system