KEGG   Francisella sp. TX077310: F7310_01625Help
Entry
F7310_01625       CDS       T05017                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
frx  Francisella sp. TX077310
Pathway
frx00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:frx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    F7310_01625
Enzymes [BR:frx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     F7310_01625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M DUF4434
Motif
Other DBs
NCBI-ProteinID: API86131
UniProt: A0A1L4BQK7
LinkDB All DBs
Position
complement(318395..320362)
Genome map
AA seq 655 aa AA seqDB search
MYFGVDYYPEQWDHSLIDKDLQRIANSELNCIRIAEFAWHLMEPQEGQFDFSFFKTILDK
AHKLNLKVMLGTPTATAPAWLYKKDPKIFSIDKNGLQRHFGGRRQACLNSPTYNKYAERI
TQKMVEAYHQHPALLLWHIDNELGHETSDMCYCDQCELEFRDYLKQQFDNNIDLFNDAIG
SVFWSQTYNDFDEINIPRPTIPAPNPGMMLYFNRFRAQTTTNFLARQAKVIKDIAPDQQT
LHNFTGDYFSKAQDHTDLAEQIDLVALNNYPVWGGQQVPVDAYKTAMKLDQTRGFKKENY
WITEQLIGAQAHNIMGFVPRPGHAKLWSFQAMARGCDNLIYFRWRTATKGAEQFCYGVLD
HDNKYNHRYDEMLDIIKLAKQNQKAIQTPTQSRVALLYSMDNIYSWRIQQQSTAFDIQHE
HTRLYKPFFDNNINVDVLDVRHDFSKYSILLLPVSMLITDKNIARIKAFIENGGTIIATF
RAGLKEYHNEIRFGVDNPIHELAGVKADYFEPLPIGTNCKIKYQNKDLTATVWRDMLTIK
GSSQSLCDYADEFKNYSAAVRNNLGKGSVYYIGTGIDDSSFWNDLVLDTTKKHNINSFQS
PDDVEVIIKGDGDSKIAIILNHNSHEVDYLGLKLNPYDTQIINYLEFSNSYSKYY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtattttggtgtcgattactacccagagcaatgggatcattcacttattgataaggat
cttcaacgtattgcaaactcagaacttaattgtattagaattgcagaatttgcttggcat
ctaatggaacctcaagaaggtcaatttgattttagtttttttaagacaatattagataaa
gcacataagctaaatctcaaagtaatgcttggtacaccaacagctacagctcctgcttgg
ttatacaaaaaagatccaaagatattctcaatagacaaaaatggcttacaaagacatttt
ggtggtagaaggcaggcttgtctaaactcaccaacatacaacaagtatgctgaacgtatt
actcagaaaatggtagaggcatatcatcaacatcctgctttattactttggcatatagat
aatgaactaggtcatgaaactagtgatatgtgctactgtgatcaatgcgagttagagttt
agagactatctaaaacagcagtttgataataacatcgacttatttaatgatgctattggc
tcagttttttggtcacaaacatataatgattttgatgagataaatatacctcgcccaact
attcctgcaccaaaccctggaatgatgttatattttaaccgttttagagcacaaacaact
accaactttttagcaagacaagctaaagttatcaaagacatagctccagaccaacaaact
ttacataactttactggggattatttctctaaggctcaagatcatacagatctagctgag
caaatagatcttgtagcactaaataactaccccgtttggggtggtcaacaggtcccagta
gatgcttataaaacagcaatgaagttagatcaaactcgaggctttaaaaaagagaactat
tggattactgagcaactgataggagctcaagctcacaatataatgggatttgtacctcga
ccaggccatgctaagttatggtcttttcaggcaatggctagaggatgtgataatctaatc
tattttagatggcgtacagcaacaaaaggtgctgagcaattctgttatggtgtcttagat
catgataacaaatataatcatcgctatgatgaaatgctagatatcattaaattagctaaa
caaaatcaaaaggcaatacaaactccaacacaatcaagagtagctcttttatattctatg
gataatatctatagctggcgtatccaacagcaatcaactgcttttgatattcagcatgag
cacactagactttataaacctttctttgataataacattaatgttgatgtactagatgtt
cgccatgattttagtaaatattcaatactcttacttccagtatctatgttaatcacagat
aagaatattgctagaatcaaagcttttattgaaaatggtggtactattatagctacattt
agagcaggtcttaaagaatatcacaatgagattcgctttggtgttgataatcctattcat
gaacttgctggtgtaaaagcagactattttgagcctctccctatagggacaaattgtaaa
atcaaatatcaaaataaagatctaactgccactgtatggcgcgatatgcttacaattaaa
ggatctagtcaatcattatgtgattatgctgatgaatttaaaaactatagtgcagctgta
agaaataatctcggtaaaggatcagtttactatattggtacaggtattgatgatagctct
ttttggaatgacttagtgctagacacgactaaaaagcataatattaatagctttcaatct
ccagatgatgttgaggttattataaaaggagatggtgattccaaaatagctattatttta
aaccacaatagtcatgaggttgactatttaggattaaaacttaatccttatgatactcag
ataataaactatttagagttctcaaattcatatagcaaatactattaa

DBGET integrated database retrieval system