KEGG   Francisella uliginis: F7310_02640
Entry
F7310_02640       CDS       T05017                                 

Definition
(GenBank) delta 9 acyl-lipid fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
frx  Francisella uliginis
Pathway
frx01040  Biosynthesis of unsaturated fatty acids
frx01100  Metabolic pathways
frx01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:frx00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    F7310_02640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:frx01004]
    F7310_02640
Enzymes [BR:frx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     F7310_02640
Lipid biosynthesis proteins [BR:frx01004]
 Desaturase
  First
   F7310_02640
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-ProteinID: API86313
UniProt: A0A1L4BR38
LinkDB
Position
complement(520208..521038)
AA seq 276 aa
MQQQSNKFTIIAFSAMHLACLAIFFVNYNITALLVFVITFSMRTFALTAGYHRYFSHKAF
QTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKETDMHSPKNGVFQAHVGWVFEA
RSDEVDPKFIKDWVKYPEIVWLDKYAHESFALYLVGLFILGSCISYFYPALGTSGLAFVF
WGGILSTVLLYHTTFSVNSICHIFGSRDYQTTDNSRNNWLVALITFGEGWHNNHHKFAYS
IRNNLKFWQIDITYMILCVLKKLRIVWDFKQPKKTA
NT seq 831 nt   +upstreamnt  +downstreamnt
atgcaacaacaatcaaataaattcacaataatagcttttagcgcaatgcacttagcatgc
ttagcaatattttttgtgaattataatattacagctcttttagtatttgttataactttt
agtatgaggacatttgcccttactgctggctatcatcgctacttctcgcataaggctttt
caaacatcacgagtatttcaatttatattagctttggtaggtacatgggcttcacagaaa
ggacctctttggtggtcaggacatcataggtaccatcatatccattcagataaagaaaca
gatatgcactctcctaagaatggagtttttcaagcccatgttggctgggtatttgaagca
agaagtgatgaggtagatcctaaatttatcaaagactgggttaagtatcctgagatagta
tggcttgataaatatgctcatgaatcttttgcattatatttagttggactttttatacta
ggtagttgtattagctacttctatccagctcttgggacttctggacttgcttttgtattt
tggggaggtatattaagtacagtactactttatcacactacttttagtgtaaattcaatt
tgccatatttttggatctagagattaccaaaccactgataatagtcgcaataattggcta
gttgccctaataacatttggtgaaggttggcacaacaatcatcataaatttgcttactca
ataagaaataatcttaaattctggcaaatagatataacttatatgatcttgtgtgtactt
aaaaagcttagaattgtctgggattttaaacagcctaagaaaactgcctaa

DBGET integrated database retrieval system