KEGG   Francisella sp. TX077310: F7310_09385Help
Entry
F7310_09385       CDS       T05017                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
frx  Francisella sp. TX077310
Brite
Enzymes [BR:frx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     F7310_09385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: API87554
UniProt: A0A1L4BUN2
LinkDB All DBs
Position
complement(2032804..2033382)
Genome map
AA seq 192 aa AA seqDB search
MKFELPNLPYAKDALEPVISKETIEYHYGKHHQTYVTNLNNLIEGTEHSGKNLEQIIKTS
SGGLFNNAAQVYNHTFYWNCFSPNKTEPSSQLKAAIVETFGSFDKFKEEFSKTAVTTFGS
GWAWLVKDSKGKLEIVSTSNAGCPLTDNKHPLLTFDVWEHAYYIDYRNARPKHVEALWDI
VNWEFVSEQFAK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgaattacctaatctaccttatgctaaagatgcgctagagcctgtgatttca
aaagaaactatagaatatcattatggtaaacatcaccaaacatatgttacaaacctaaat
aacctaatagaaggaacagagcattcaggtaaaaacttagaacaaataatcaaaacatct
tcaggtggtttatttaataatgcagctcaagtttataaccatacgttttattggaattgc
ttctctccaaataaaactgagccatctagtcagttaaaagcagctatcgtagagactttt
ggttcttttgataagtttaaggaagagttctctaaaactgcagtaactacgtttggttct
ggttgggcttggctagttaaggattcaaaaggtaagttagagatcgttagcacaagtaac
gcaggttgtcctttaactgataacaagcatcctttactaacttttgatgtttgggagcat
gcttattatattgattaccgtaatgctagacctaagcatgttgaggctttatgggatata
gttaactgggaatttgtatctgagcaatttgcaaaataa

DBGET integrated database retrieval system