KEGG   Fastidiosipila sanguinis: C5Q98_02515Help
Entry
C5Q98_02515       CDS       T05345                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fsa  Fastidiosipila sanguinis
Brite
KEGG Orthology (KO) [BR:fsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fsa01001]
    C5Q98_02515 (pknB)
Enzymes [BR:fsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C5Q98_02515 (pknB)
Protein kinases [BR:fsa01001]
 Serine/threonine kinases: Other
  Bacterial family
   C5Q98_02515 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Kdo
Motif
Other DBs
NCBI-ProteinID: AVM42172
UniProt: A0A2S0KMB4
LinkDB All DBs
Position
complement(601870..603861)
Genome map
AA seq 663 aa AA seqDB search
MVLQITLQLLWDLFSEVYMSISVGTILNNRYKILELAGTGGMAKVYKATDLNTGEVVAIK
TLKSEYNDDLEFVRRFDLEARAAASLSHPNIVNVYGVGEDNGVKYIVQEYVNGKSLKEKL
EETGKMDWRLAVPIVIQIALALEHAHSQSIVHRDIKPANILITPDGVCMVTDFGIARATN
SNTVSMTGGTALGSVHYFSPEQARGGAVDHRSDVYSLGILMYELLTGEVPFDGESSVAVA
VKQLQEEPVKPRELESSIPQGLEDIILRCMQKNPNKRYPDSRALIDDLDMFMINPNGRYG
EINSSNDTYSNYADPSAITEPQDTFNSESNSLDRVLSLENSISSRRKSRSRDTVITMLFV
VIIVLLLSLAIWFIADSVKNNLSTRESAAEEIYVVEDFRNMSYDEVSQKLKAEGVNHIKV
EEASEEVSSGNIISQNIAPGSEINRAGTFVKGSELILTVSKGSEFYVIPNLIGEDGAEVK
NTIEKENILVMTRSQFNLSVPEGKVVEISPSPGTKVERGSRITITISKGINKGPVPDVKG
RKLDSAIEYLNSIGFDTETRVPSSLKGYESSLYVVDMTPKAGTSNVTEKIVLIAGTYEEA
NPTTATTTEKPSETTTVETTETEKTETEASTEKPEDNTPEPTEPTEPSAEEPVDPGAPAD
AGN
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggtgctccagataacgttacagttattgtgggatttatttagtgaggtatacatgtct
attagtgttggaacaattttaaataatcgctataaaatattagaactcgctggtactgga
ggtatggcaaaagtttataaggccaccgacttaaatactggtgaggtagtagctattaaa
actttaaaatctgaatataatgatgatttagaatttgttagacgttttgatcttgaagca
agagctgcagcaagtttgtctcatcctaatatcgtaaatgtgtatggtgtaggtgaagat
aacggtgttaagtacattgttcaagagtatgttaatggtaaaagtctaaaagagaagtta
gaagaaaccggaaaaatggactggcgcttggcagttccaattgttatacaaattgcattg
gctcttgaacatgctcattcacaatctatagttcatagagatattaaacctgcaaatatt
ttgatcactccagacggtgtctgtatggtcactgattttggtatagctagagcaactaat
tcaaatactgtttcaatgactggtggcactgcactaggctcagtacattacttttctcct
gaacaagctcgtggtggtgctgttgaccatcgctcagatgtttattctttaggaatttta
atgtatgagttattaactggtgaagtaccattcgacggagaatcttcagtagcagtagcg
gtaaaacaattacaagaagaaccggtaaaaccaagagaattagaatcatctattccacaa
ggattagaggatattatacttcgttgcatgcaaaaaaatccaaataaacgctatcctgat
tccagagctttaatcgatgatctggatatgtttatgattaatccaaatggtagatatggt
gagattaatagctcaaatgatacttacagtaattatgctgatccaagtgctataacagaa
cctcaagatacatttaactctgaatccaattctttagatagagtcttaagcttagaaaac
tcaatcagttctagacgtaagtctagatcaagagatactgttattactatgcttttcgta
gttataatagttttattattaagtctagcaatctggtttatcgccgactctgtaaaaaac
aatcttagcacacgtgaatctgctgcagaagaaatctatgttgtagaagacttccgtaac
atgtcatatgatgaagtttctcaaaaacttaaagcagaaggagtaaatcatattaaagtt
gaagaggccagtgaagaagtatctagtggtaatattatttctcaaaacatagctccaggt
tcagaaataaatagagctggtaccttcgtaaaaggtagtgaacttattctaacagtttct
aaaggaagtgaattctatgtaattcctaatttaataggagaggatggagctgaagtcaaa
aacactattgaaaaagaaaatattctagtaatgacaagaagtcaatttaacctttctgtt
cctgaaggtaaggttgtagaaatatctccatctcctggaacaaaggttgaacgtggttca
agaataactattacaattagtaaaggtattaataagggtccagttcctgatgttaaaggt
aggaaattagattctgctattgagtatctaaattctattggttttgatacagaaacaaga
gtgccttctagtttgaagggttatgaaagtagtttatacgttgttgatatgacaccaaaa
gctggtacatctaatgtaactgaaaagatagtccttatagcaggaacctatgaagaagcc
aatcctacaacagcaaccactacagaaaaaccgagcgagaccacaacggttgagaccacc
gaaacagaaaaaactgagacggaagcaagcactgaaaaacctgaagataatactccagaa
ccaacagagcctactgaaccatcagcagaagaacctgtagatcctggtgctcctgctgat
gccggtaactaa

DBGET integrated database retrieval system