KEGG   Fibrobacter succinogenes: FSU_1439Help
Entry
FSU_1439          CDS       T02105                                 

Definition
(GenBank) putative phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
fsc  Fibrobacter succinogenes
Pathway
fsc00440  Phosphonate and phosphinate metabolism
fsc01100  Metabolic pathways
fsc01120  Microbial metabolism in diverse environments
fsc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fsc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    FSU_1439
Enzymes [BR:fsc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     FSU_1439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ADL25488
UniProt: C9RPD4
LinkDB All DBs
Position
complement(1669429..1670739)
Genome map
AA seq 436 aa AA seqDB search
MAKTVYLGMIGDIMHPGLINIINEGAKYGDVMIGLFTDKAIATHKRLPYLNYEQRKNVIE
NIKGVSKIVPQDEWSYVENLKRYKPDYIIHGDDWLYGPDKYIRDEVFKVMESLGGKVIEI
PYTKGITSAGLKKEMDSLGTTPQARLSSLRRLIAAKPIVRILESHNGLTGLIAEHTSVEI
NGCVREFDGMWSSSLTDSTSKGKPDIEAVDLTTRLHDLNDTLEVTTKPVIFDGDTGGKVE
HFGFTVRTLERLGISAVIIEDKVGLKQNSLFGTDAIQSQDTIEGFCTKIRAGKEAQITDD
FMVISRCESLIAGKSVDDALERCHAYVAAGTDGIMIHSKDKSGEDIKEFCKRFREKDAHT
PIVAVPTTYNQFTEEELSTWGINIVIYANHMLRSAYPAMVKCAESILTHSRSLEASNDYC
MPIKQILNLIPGTMKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacagtatatctaggaatgattggtgacatcatgcacccgggccttatcaac
atcatcaatgaaggcgcaaagtacggtgatgtgatgattggactttttacggataaggcg
attgcaacgcacaagcgccttccgtatctgaattacgagcagcgcaagaacgtcatcgag
aacatcaagggcgtatcaaagattgttccccaggatgaatggagttatgttgaaaacttg
aagaggtacaagccggactatatcattcatggtgatgactggctttacggcccggacaag
tatatccgtgacgaggtgttcaaggttatggaatccttaggtggcaaggttattgaaatc
ccttacaccaagggcattacttctgctggcctcaaaaaggaaatggatagcctcggtacg
acaccacaggcgagactttcttcactgcgccgcctgattgcggccaagccgattgttcgt
attttggaatctcataatggccttacgggcttgattgctgaacatacgagtgttgaaatc
aacggctgcgttcgcgagtttgacggtatgtggtcttcttcgctcaccgattccacgagt
aaggggaagccggatatcgaggctgtggaccttacgactcgtctgcatgacttgaatgat
acgctcgaagtcacgacaaagccggttatctttgatggcgatacgggtggaaaggtcgaa
cattttggctttactgtgcgcacgctcgaacgccttggcatttctgcggtcatcattgaa
gacaaggttggcctcaaacagaactctctgtttggtacagatgctattcaatcgcaggat
acgattgaaggtttctgcacaaaaatacgtgcgggcaaggaagcccagattacggacgac
ttcatggtgatctcccgctgcgaatcgctcattgcgggcaagtccgtggacgatgccttg
gaacgttgccatgcctacgtggccgccggtactgatggcatcatgatccattccaaggac
aaaagcggcgaagacatcaaggaattctgcaagcgtttccgcgagaaggacgctcatacg
ccgattgttgcagtacccacgacctacaaccagtttactgaagaggaactttcgacttgg
ggtatcaacattgtcatctatgcaaaccacatgcttaggtctgcatacccggcgatggtg
aagtgtgcggagtccatccttacgcacagccgtagcctcgaagcttcaaacgactactgc
atgcctatcaagcagattttgaaccttattcccggaacgatgaagaagtaa

DBGET integrated database retrieval system