KEGG   Flexistipes sinusarabici: Flexsi_0133Help
Entry
Flexsi_0133       CDS       T01539                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00970  Aminoacyl-tRNA biosynthesis
fsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Flexsi_0133
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fsi03029]
    Flexsi_0133
Enzymes [BR:fsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Flexsi_0133
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Flexsi_0133
Mitochondrial biogenesis [BR:fsi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Flexsi_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase HTH_24
Motif
Other DBs
NCBI-ProteinID: AEI13829
UniProt: F8E7B4
LinkDB All DBs
Position
137851..139311
Genome map
AA seq 486 aa AA seqDB search
MNLLNADLKILRSYLEDGRISAKELVQFYLDRINKYDDKLKSFVSINEDALSQAEKIDVK
RRNGEKLPPMAGIPIALKDNMVTKGLRTTCSSHILENFDPVYDGTVAKQLKEEGFIILGK
LNMDEFAMGSSCESSYFGKTKNPWDTERVPGGSSGGAAAAVSARLIPASLGSDTGGSIRQ
PASFCGIAGFKPTYGRVSRFGLVAFASSLDQIGPMTWNVQDSVELMKIIGKHDHHDSTSA
SKNSFEPYDKKLDNLKGIKIGVPEEYFKEGLSPEVEASVKDAIKHLESLGAEIINIRMPH
TDYAVAVYYILATAEASSNLARYDGVRYGYRAEAENLSEMYVKTRSEGFGDEVKRRIMLG
TYVLSAGYYDAYYLKAQRVRTLIKNDFLDAFAKVDAIVAPTSPTTAFKIGEKVEDPLSMY
LSDIFTLSLNLFGGCGISVPCGFDSNNLPIGLQILGNYFDEAKILEIADCYQKNTAWHTK
IPPEFE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaatctactgaatgcagatctgaagatattgaggtcttatctggaggacggcagaatt
tctgcaaaggaacttgtacagttttatcttgatagaattaataaatatgatgacaaactt
aaatcttttgtttccataaatgaggatgcactgtcccaagcggaaaaaattgacgtgaaa
agacgtaacggtgagaaactgccgccgatggcgggaataccgatagctttgaaagacaat
atggtgactaaggggctgagaaccacctgttcgtcgcatatcctggaaaatttcgacccc
gtttacgacggaactgttgcaaagcagctgaaagaagaaggttttattatactcggaaaa
cttaatatggatgaatttgccatgggttcatcctgtgaatcctcctactttggtaaaaca
aaaaatccgtgggatactgagagggtgccgggcggctcgagcggtggtgccgcagctgca
gtgagtgctcgtttgattcccgcatccctgggaagtgatacgggtggctcgataagacag
ccggcttctttttgcggtattgccggctttaaaccgacatatggcagagtttcaaggttc
ggcctggttgcttttgcttcaagtcttgatcagattggcccaatgacatggaatgttcag
gacagtgtggaactgatgaaaattattggaaaacatgaccatcacgattccacctcggct
tccaaaaattcattcgaaccttatgataaaaaacttgataatttgaaaggaataaaaatc
ggcgtccccgaggaatatttcaaagagggtctgagtccggaagttgaagcatctgtaaaa
gacgccataaaacatcttgaatcccttggtgctgaaattatcaacatacgtatgccccat
acagattacgcagtggctgtttattatatacttgccacggccgaggcttcgagtaacctg
gcccgttatgacggtgtcagatacggatacagagctgaggctgaaaatttgtctgaaatg
tatgtgaaaacccgttctgaaggattcggtgacgaagttaaaaggcggataatgctcggt
acatatgtgttaagtgccggctactatgatgcttattatttgaaggctcagagagtcaga
acacttatcaaaaatgatttccttgatgcttttgcaaaagttgatgcaatagttgcgcct
acttctccgacaactgcttttaaaattggcgagaaggtggaagatcctttgagtatgtat
ttgagtgatatttttaccctttcactgaaccttttcggtggatgcggcatttcagtacca
tgcggttttgacagcaataatcttcccataggtctgcagattctcggtaactattttgat
gaggctaagattctcgaaattgcagattgttaccagaaaaatacggcttggcacacaaaa
atacctccggaatttgaataa

DBGET integrated database retrieval system