KEGG   Flaviflexus salsibiostraticola: EJO69_04635Help
Entry
EJO69_04635       CDS       T05752                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fsl  Flaviflexus salsibiostraticola
Pathway
fsl00010  Glycolysis / Gluconeogenesis
fsl00030  Pentose phosphate pathway
fsl00051  Fructose and mannose metabolism
fsl00052  Galactose metabolism
fsl00680  Methane metabolism
fsl01100  Metabolic pathways
fsl01110  Biosynthesis of secondary metabolites
fsl01120  Microbial metabolism in diverse environments
fsl01130  Biosynthesis of antibiotics
fsl01200  Carbon metabolism
fsl01230  Biosynthesis of amino acids
fsl03018  RNA degradation
Module
fsl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EJO69_04635
   00030 Pentose phosphate pathway
    EJO69_04635
   00051 Fructose and mannose metabolism
    EJO69_04635
   00052 Galactose metabolism
    EJO69_04635
  09102 Energy metabolism
   00680 Methane metabolism
    EJO69_04635
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EJO69_04635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fsl01009]
    EJO69_04635
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fsl03019]
    EJO69_04635
Enzymes [BR:fsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EJO69_04635
Protein phosphatases and associated proteins [BR:fsl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EJO69_04635
Messenger RNA biogenesis [BR:fsl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EJO69_04635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AZN29670
LinkDB All DBs
Position
971829..974081
Genome map
AA seq 750 aa AA seqDB search
MGIMEPVKIAVLTSGGDAQGMNAIVRAVIRTALHEGARPFAIREGWKGAVEGGDLIREMS
WGDVSTILHRGGTIIGTARSDRFREREGMRAAAKNLVSLGIDRIVSIGGDGTLTGTNELK
LQWSSLLAELVELGEIDQETADRHPTLRIAGVVGSIDNDLVGTDMTVGADSALHRIIDAV
DAISSTAESHRRSFVIEVMGRHCGYLALMSAIAGGCDYVFVPEMPPADGWEDDMCRVLRA
GRKAGRRDSIIIVAEGATDRRGERITSERVAQALEAGLGEEARVTLLGHVQRGGPPSAYD
RWMPTLLGYTATLELLRSDGEPVIIGTRRNRLVRLPLMQAVEDTRAVKTYTAEGDYRRAV
ESRGSSYAEMIDVFSTLSSPVPRRAPSAKRRRIAIVHVGGLAPGMNAAARTAVRFGIDHG
YDMVGVQNGLPGLVDGDIIPLSWSDVDSWSGSGGAELGTRRTIPPVEDFYTMGRTLEEQE
IDGLLIIGGLNGYEAAALMKEERRRFPAFRIPIMCVPASIDNNLPGSELSIGADTALNTN
VEVLNRIKQSASASRRCFVAEVMGRNAGYLALMSAIASGAEQVYLAETGITLKQLETDTK
VMIDAFENGRRLYLVVRNEYASEHYTTDFLARLFEAEGKELFDVRQAVIGHQQQGGNPSP
FDRLLAVRLIRRAMEKLDSLLVQGRDDCAYVGMAEGQISCHPLSRMEEQWDPRTRLPYDQ
WWLGLKDVAYIVSNPHHSGPAEVLPIVEDA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggggatcatggaaccagtgaagattgccgtcctgacatcgggcggcgatgcccagggg
atgaacgccattgtccgcgccgtcatccgcaccgcactccacgagggcgcccggcccttc
gccatccgggaggggtggaagggcgccgtcgagggcggcgacctcatccgggagatgtcg
tggggcgatgtctcgacgatcctccaccggggcgggaccatcatcggcaccgcccggtcc
gaccggttccgtgaacgcgagggcatgcgcgccgccgcgaagaacctcgtgtcgctcggc
atcgatcgcatcgtctccatcggcggcgatggaaccctgacgggcacgaacgagctcaag
ctccagtggtcctcgcttctggccgagctcgtcgagctcggggagatcgaccaggagacg
gcggaccgacacccgaccctgaggatcgccggtgtcgtcggttccatcgacaacgacctc
gtcggaaccgacatgaccgtcggagccgattcggccctccaccgcatcatcgatgcggtg
gatgcaatctcgtcgacggcggagtcgcaccggcgctccttcgtcatcgaggtcatgggc
cgccactgcggctacctcgccctcatgagcgccatcgccggcggctgtgactacgtcttc
gttccggagatgcccccggcggacggctgggaggacgacatgtgccgggtcctgcgggcc
ggccggaaggcgggccgacgggattcgatcatcatcgtcgccgagggcgccaccgaccgg
aggggcgagcggatcacctcagagcgggtggcccaggccctcgaggcgggcctcggcgaa
gaggctcgggtgacccttctcgggcacgtccagcgcggcgggccaccctccgcctacgac
cggtggatgccgactctgctcggctacacggcgacgctcgagctgctgcgcagcgacggc
gagcccgtcattatcggcacgcgccgcaatcgactcgtccgcctgccgctcatgcaggcg
gtggaggacacgcgtgccgtcaagacctacaccgcggagggcgattaccggcgggccgtt
gaatcgcggggctcgtcctacgcggagatgatcgacgtcttctcgacgctctcctccccg
gtcccgcggagagctccctccgcgaagcgacgccggatcgccatcgtccacgtcggtggg
ctggcgccgggcatgaatgccgccgctcggacagccgtccggttcggcatcgaccacggc
tacgacatggtcggggtccagaacggactgcccggcctcgtcgacggggacatcatcccc
ctgtcctggtccgacgtcgactcctggtcgggttcgggcggagccgagctcggcacccgc
aggaccatcccgcccgtcgaggacttctacaccatgggccgaaccctcgaggagcaggag
atcgatggtctcctcatcatcggcggcctcaacggctacgaggcggccgcgctcatgaag
gaggagcgccggcgcttccccgccttccggatccccatcatgtgtgtgcccgcctccatc
gacaacaacctgcccggctccgaactctcgatcggtgcggacacggcgctcaacaccaac
gtcgaggtgctcaacaggatcaagcagtccgcctccgcgtcccggcgctgcttcgttgcc
gaggtcatgggccgcaacgcgggctatctcgccctcatgtccgccatcgcctccggtgcg
gagcaggtctatctcgccgagaccgggatcaccctcaagcagctcgagaccgacacgaag
gtcatgatcgacgcctttgagaacggcaggcgcctctatctcgtcgtgcggaacgagtac
gcctcagagcactacacgacggacttcctcgcccgactgttcgaggccgaggggaaggag
ctgttcgacgtgcggcaggccgtcatcggccaccagcagcagggcggcaacccgtcgccc
ttcgacaggctcctcgccgtccggctcattcggcgggcaatggagaaactcgactccctc
ctcgtccagggccgggacgactgcgcctacgtcggcatggcggaggggcagatcagctgt
cacccgctctctcggatggaggagcagtgggatccgcggacgcgcctgccgtacgaccag
tggtggctcggactgaaggacgtcgcctacatcgtctccaaccctcaccacagcggaccc
gcggaggtcctgccgatcgtcgaggacgcgtaa

DBGET integrated database retrieval system